ruvector/data/training/brain_corpus.jsonl
rUv e6d4f505a5 data: add merged training corpus (230 records, 530K tokens)
98 brain memories + 131 ADRs + 1 routing reference.
Governance: SHA-256 dedup, quality >= 0.5, schema validated.

Co-Authored-By: claude-flow <ruv@ruv.net>
2026-03-28 12:03:23 +00:00

100 lines
588 KiB
JSON

{"id": "002a0ba3-8c20-4403-b259-0e2c5a9be00a", "source": "brain", "text": "NCBI BlastRule accession NBR005628\n\nNCBI BlastRule accession NBR005628\nSkip to main page content\nAn official website of the United States government\nHere's how you know\nThe .gov means it\u2019s official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you\u2019re on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard\nPublications\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nProtein Family Models\nSearch\nAdvanced Documentation\nThe model on this page is part of a hierarchical collection of curated Hidden Markov Model-based and BLAST-based protein families (HMMs and BlastRules), and Conserved Domain Database architectures used to assign names, gene symbols, publications and EC numbers to the prokaryotic RefSeq proteins that meet the criteria for inclusion in a family. HMMs and BlastRules also contribute to structural annotation by NCBI's Prokaryotic Genome Annotation Pipeline (PGAP) (Read more).\nDetails\nNCBI BlastRule accession\nModel protein\nRepresentative protein(s) of the BlastRule protein family.\nProduct name\nName propagated to proteins best supported by this BlastRule ( Read more ).\nFamily type\nThe family type indicates the BlastRule specificity and the diversity of protein hits. (Read more)\nGene symbol\nEC number(s)\nGO term(s)\nIdentity cutoff (%)\nThe minimum percent sequence identity between the model protein and a target protein.\nTarget coverage cutoff (%)\nThe minimum percentage of a target protein\u2019s length that must be aligned to the model protein by BLAST.\nModel coverage (%)\nThe minimum percentage of the model protein\u2019s length that must be aligned to a target protein by BLAST.\nNumber of RefSeq protein hits\nThe number of RefSeq proteins with identity and coverage above the BlastRule\u2019s identity and coverage cutoffs, respectively.\ncounting ...\nLast updated\nReferences\nProtein hits\nNamed by this model (...)\nOther hits (...)\nNo RefSeq protein is named by this evidence.\nFailed to load data from server. Please refresh the page to try again.\nAll matching RefSeq proteins are named by this evidence.\nFailed to load data from server. Please refresh the page to try again.\nNo data found. Please try again.\nLinks\nSimilarly-named families\nSearch PubMed\nView hits in MicroBIGG-E\nDownload all HMMs\nFollow NCBI\nTwitter\nFacebook\nLinkedIn\nGitHub\nConnect with NLM\nSM-Twitter\nSM-Facebook\nSM-Youtube\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nHelp\nAccessibility\nCareers\nNLM\nNIH\nHHS\nUSA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/002a0ba3-8c20-4403-b259-0e2c5a9be00a", "content_hash": "0bbe2db611f8929cab17c1e029bd103e8f7a167284cc5fa71b2fa1dc3bc12c01", "created_at": "2026-03-28T05:13:08.013913051Z"}
{"id": "31cbea1b-9338-411f-b969-ca304e947eb1", "source": "brain", "text": "CDD Conserved Protein Domain Family: SAM_EPH-B3\n\nCDD Conserved Protein Domain Family: SAM_EPH-B3\nConserved Protein Domain Family\nSAM_EPH-B3\nEntrez CDD Structure Protein Help\n?\ncd09553: SAM_EPH-B3\nDownload alignment\nSAM domain of EPH-B3 subfamily of tyrosine kinase receptors\nSAM (sterile alpha motif) domain of EPH-B3 subfamily of receptor tyrosine kinases is a C-terminal potential protein-protein interaction domain. This domain is located in the cytoplasmic region of EPH-B3 receptors and appears to mediate cell-cell initiated signal transduction. EPH-B3 receptor protein kinase performs kinase-dependent and kinase-independent functions. It is known to be involved in thymus morphogenesis, in regulation of cell adhesion and migration. Also EphB3 controls cell positioning and ordered migration in the intestinal epithelium and plays a role in the regulation of adult retinal ganglion cell axon plasticity after optic nerve injury. In some experimental models overexpression of EphB3 enhances cell/cell contacts and suppresses colon tumor growth.\nLinks\n?\nSource: cd09488\nTaxonomy: Tetrapoda\nPubMed: 14 links\nProtein: Representatives\nSpecific Protein\nRelated Protein\nRelated Structure\nArchitectures\nSuperfamily: cl15755\nStatistics\n?\nPSSM-Id: 188952\nAligned: 3 rows\nThreshold Bit Score: 145.946\nCreated: 10-May-2010\nUpdated: 2-Oct-2020\nStructure\n?\nAligned Rows:\nDownload Cn3D\nConserved Features/Sites ?\nPubMed References?\nputative\nFeature 1:putative phosphorylation site [posttranslational modification site]\nEvidence:\nComment:Highlighted tyrosine is a potential phosphoregulatory site and histidine is its bonding partner (phosphorylated upon activation by ephrin).\nCitation:PMID 9886291\nScroll to Sequence Alignment Display\nSequence Alignment\ninclude consensus sequence ?\nFormat: Hypertext Plain Text mFasta Compact Hypertext Compact Text Row Display: Color Bits: 0.5 bit 1.0 bit 1.5 bit 2.0 bit 2.5 bit 3.0 bit 3.5 bit 4.0 bit Identity Type Selection: top listed sequences the most diverse members\n\nFeature 1 # # \nQ91735 898 PDYTTFPTVSDWLEAIKMGQYQENFLSAGFTSFHLVAQMTAEDLLRIGVTLAGHQKKLLNSVQDMRLQM 966 African clawed frog\nQ07498 912 PDYTTFTTVGDWLDAIKMGRYKENFVNAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQM 980 chicken\nP54753 922 PDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQM 990 human\nCiting CDD\nJiyao W et al.(2023). \"The conserved domain database in 2023.\", Nucleic Acids Res. 51(D1):D384-D388.\n| Disclaimer | Privacy statement | Accessibility |", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/31cbea1b-9338-411f-b969-ca304e947eb1", "content_hash": "7f2bae89aa10ef44c1eb416b35dc5c6b793a6aa9042c00c8e38c0f521ef2daca", "created_at": "2026-03-28T05:13:07.891433121Z"}
{"id": "96d61d85-649f-4447-af1b-ae78753f7160", "source": "brain", "text": "Social and Environmental Justice | Social Sciences | MDPI\n\nSocial and Environmental Justice | Social Sciences | MDPI\nSkip Content\nYou are currently on the new version of our website. Access the old version\nhere\n.\nClose\nJournals\nAll Journals\nJournal Finder\nProceedings Series\nPropose a Journal\nTopics\nBy Subjects\nBiology & Life Sciences\nBusiness & Economics\nChemistry & Materials\nComputer Science & Mathematics\nEngineering\nEnvironmental & Earth Sciences\nMedicine & Pharmacology\nPhysical Sciences\nPublic Health & Healthcare\nSocial Sciences, Arts & Humanities\nOur Topics\nAll Topics\nAbout Topics\nTopics Awards\nSubject Editors\nPropose a Topic\nAuthor Services\nInformation\nPublishing\nOpen Access Policy\nEditorial Process\nPublication Ethics\nSpecial Issues Guidelines\nArticle Processing Charge\nPublishing Services\nGuidelines\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nPartnerships\nSocieties\nConferences\nInstitutional Open\nAccess Program\nAbout\nCompany\nAbout Us\nMission\nImpact\nHistory\nLeadership\nOffice Locations\nAwards\nCareers\nProducts\nMedia\nNews\nBlog\nContact\nSupport\nSend Feedback\nSearch\nOpen mobile navigation\nHome\nJournals\nSocial Sciences\nSpecial Issues\nSocial and Environmental Justice\nSubmit to Social Sciences\nBecome a Reviewer\n1.7\nImpact Factor\n3.1\nCiteScore\n34 days\nTime to First Decision\nInstructions for Authors\nContent\nBrowse By\nSpecial Issues\nTopics\nTopical Collections\nAll Sections\nJournal Issues\nUpcoming Issue\nCurrent Issue\nAll Issues\nAll Volumes\nArticles\nMost Recent\nMost Cited\nMost Viewed\nEditor\u2019s Choice\nGuidelines\nEditor Guidelines\nReviewer Guidelines\nEditorial Procedures\nEthics Guidelines\nSpecial Issue Guidelines\nAbout\nJournal Information\nAims & Scope\nIndexing & Archiving\nArticle Processing Charge\nStatistics\nNews & Conferences\nHistory\nAwards\nEditorial Office\nJournal Boards\nEditorial Board\nTopical Advisory Panel\nSearch\nJournal Menu\nSocial and Environmental Justice\nSpecial Issue Information\nDear Colleagues,\nCurrent social, economic, and political systems throughout the world have fostered profound injustice and resulted in unconscionable phenomena such as environmental degradation, racism, ableism, sexism, poverty, and rising inequality of access to resources and information. Many of these problems are worsening by the day, leading to an increased risk of social and environmental collapse. In response, a substantial body of scholarship has attempted to contribute to increasing social and environmental justice. However, few efforts have been made to integrate different perspectives on justice issues in a way that can form a systematic foundation for a deep societal shift in mindset and practices.\nThese ideas motivate this Special Issue and are the bases for the Fordham University 2023 International Conference on Social and Environmental Justice. This Special Issue aims at addressing social and environmental justice in accessing natural and technological resources and knowledge nationally and globally. Collectively, this Issue will seek to understand how such conditions relate to history, structural adjustment programs, and worldwide policies that affect communities, habitats and species, and environmental regulations and standards all over the world. This Special Issue will cover subjects related to environmental justice, immigration justice, disability justice, digital and information access justice, and gender and sexuality.\nArticles should be between 5000 and 10,000 words and follow the guidelines of the journal. The guidelines and call for papers can also be found on the journal website: https://www.mdpi.com/journal/socsci. The submission deadline is August 31, 2023. For further details on the submission process, please see the instruction for authors on the journal website: https://www.mdpi.com/journal/socsci/instructions. The journal mandates two outside reviewers for all submissions. Publication normally occurs 6\u20138 weeks after the final draft submission. The Special Issue waives submission and publication fees.\nSocial Sciences is ranked 75/263 (Q2) in the Social Science-Interdisciplinary category of the JCR and is ranked 50/264 (Q1). It is ranked in the General Social Sciences category with a CiteScore of 3.4 for 2021, and it publishes on a wide range of disciplines including history, anthropology, and sociology. The journal boasts a rigorous yet fast peer-review system, which is demonstrated by a manuscript rejection rate of 72.32% and median processing time of 54 days in 2021.\nProf. Dr. Steven J. Franks\nProf. Dr. Z. George Hong\nProf. Dr. Sophie Mitra\nDr. Nicholas Paul\nDr. Aseel Sawalha\nGuest Editors\nManuscript Submission Information\nManuscripts should be submitted online at www.mdpi.com by registering and logging in to this website. Once you are registered, click here to go to the submission form. Manuscripts can be submitted until the deadline. All submissions that pass pre-check are peer-reviewed. Accepted papers will be published continuously in the journal (as soon as accepted) and will be listed together on the special issue website. Research articles, review articles as well as short communications are invited. For planned papers, a title and short abstract (about 250 words) can be sent to the Editorial Office for assessment.\nSubmitted manuscripts should not have been published previously, nor be under consideration for publication elsewhere (except conference proceedings papers). All manuscripts are thoroughly refereed through a double-blind peer-review process. A guide for authors and other relevant information for submission of manuscripts is available on the Instructions for Authors page. Social Sciences is an international peer-reviewed open access monthly journal published by MDPI.\nPlease visit the Instructions for Authors page before submitting a manuscript. The Article Processing Charge (APC) for publication in this open access journal is 1800 CHF (Swiss Francs). Submitted papers should be well formatted and use good English. Authors may use MDPI's English editing service prior to publication or during author revisions.\nKeywords\nsocial justice\nenvironmental justice\neconomic justice\ndisability justice\nimmigration justice\ndigital access justice\nBenefits of Publishing in a Special Issue\nEase of navigation: Grouping papers by topic helps scholars navigate broad scope journals more efficiently.\nGreater discoverability: Special Issues support the reach and impact of scientific research. Articles in Special Issues are more discoverable and cited more frequently.\nExpansion of research network: Special Issues facilitate connections among authors, fostering scientific collaborations.\nExternal promotion: Articles in Special Issues are often promoted through the journal's social media, increasing their visibility.\nReprint: MDPI Books provides the opportunity to republish successful Special Issues in book format, both online and in print.\nSpecial Issue Policies\nPublished Papers\nSubmit to this Journal\nBecome a Reviewer\nSubmission deadline 30 September 2023\nViews 12,295\nSpecial Issue Editors\nSteven J. Franks\nProf. Dr. Steven J. Franks\nGuest Editor\nEmail\nWebsite\nDepartment of Biological Sciences, Fordham University, Bronx, NY 10458, USA\nInterests: environmental justice; evolutionary ecology; invasive species; plant responses to climate change\nZ. George Hong\nProf. Dr. Z. George Hong\nGuest Editor\nEmail\nWebsite\nGraduate School of Religion and Religious Education, Fordham University, Bronx, NY 10458, USA\nInterests: digital humanities; digital access justice; history; social justice\nSophie Mitra\nProf. Dr. Sophie Mitra\nGuest Editor\nEmail\nWebsite\nEconomics, Fordham University, Bronx, NY 10458, USA\nInterests: disability; health; economic insecurity; human development\nNicholas Paul\nDr. Nicholas Paul\nGuest Editor\nEmail\nWebsite\nCenter for Medieval Studies, Fordham University, Bronx, NY 10458, USA\nInterests: medieval political cultures; religion and conflict; history and memory; digital humanities\nAseel Sawalha\nDr. Aseel Sawalha\nGuest Editor\nEmail\nWebsite\nAnthropology, Fordham University, Bronx, NY 10458, USA\nInterests:", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/96d61d85-649f-4447-af1b-ae78753f7160", "content_hash": "5221981cc598a728daee2734fbaa72dc26d5b20a21b81a11e3d5a51b516e9c18", "created_at": "2026-03-28T05:13:07.798645587Z"}
{"id": "4068eebe-d980-4d4e-bb22-cb71cf3ea0eb", "source": "brain", "text": "Les pieds dans la mare - Maison P\u00eache et Nature des C\u00f4tes d'Armor - Jugon les lacs\n\nLes pieds dans la mare - Maison P\u00eache et Nature des C\u00f4tes d'Armor - Jugon les lacs\nNous contacter\nPlan d\u2019acc\u00e8s et horaires\nAccueil\nL\u2019association\nAgenda des sorties\nAnimations groupes\nGroupes scolaires\nGroupes de loisirs\nP\u00eacher \u00e0 Jugon-Les-Lacs\nFacebook\nS\u00e9lectionner une page\n\u00ab Tous les \u00c9v\u00e8nements\nCet \u00e9v\u00e8nement est pass\u00e9.\nLes pieds dans la mare\n23 avril 2024 - 14 h 30 - 16 h 30\n\u00ab Initiation p\u00eache aux leurres \u2013 Belle-Isle-en-Terre\nInitiation p\u00eache de la carpe \u2013 Jugon-les-lacs \u00bb\nPartez \u00e0 la recherche des t\u00eatards, grenouilles et autres bestioles de la mare ! Accompagn\u00e9 d\u2019un animateur nature passionn\u00e9, vous arpen terez les berges de la mare o\u00f9, muni d\u2019une \u00e9puisette, vous ferez connaissance avec un monde fascinant\u2026\nInsectes, amphibiens et mollusques aquatiques n\u2019auront plus de secret !\nPr\u00e9voir des bottes et des v\u00eatements adapt\u00e9s \u00e0 la m\u00e9t\u00e9o du jour.\nPour enfants et adultes ; \u00e0 partir de 3 ans (-8 ans accompagn\u00e9 d\u2019un adulte payant). Tarif : 6\u20ac/participant\nRetrouvez le programme des animations en PDF \u00e0 t\u00e9l\u00e9charger ici !\nR\u00e9servation au ligne ci-dessous (recherchez la date de votre choix en vert ; si la date n\u2019apparait pas en vert c\u2019est qu\u2019elle est compl\u00e8te) :\nChargement en cours\u2026\nAjouter au calendrier\nGoogle Agenda\niCalendar\nOutlook 365\nOutlook Live\nD\u00e9tails\nDate : 23 avril 2024\nHeure :\n14 h 30 - 16 h 30\nCat\u00e9gorie d\u2019\u00c9v\u00e8nement: Sortie nature\nOrganisateur\nMaison P\u00eache et Nature\nT\u00e9l\u00e9phone <IP_1>.04\nLieu\nEtang de Jugon\n48.403582, -2.320074 + Google Map\nT\u00e9l\u00e9phone <IP_1>.04\n\u00ab Initiation p\u00eache aux leurres \u2013 Belle-Isle-en-Terre\nInitiation p\u00eache de la carpe \u2013 Jugon-les-lacs \u00bb\nMaison P\u00eache et Nature\ndes C\u00f4tes d'Armor\n2 Rue des Grands Moulins,\n22270 Jugon-les-Lacs\nT\u00e9l. : 02 96 50 60 04\nNos partenaires\nShare This\nPartager sur Facebook\nPartager sur Twitter", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/4068eebe-d980-4d4e-bb22-cb71cf3ea0eb", "content_hash": "64586290fc40619227b073ceb85f1791c77c58131f54d0a63484f9a79fee8f0e", "created_at": "2026-03-28T05:13:07.661498626Z"}
{"id": "a0f2927f-bcb3-4ea7-9084-77f4caf54047", "source": "brain", "text": "Contact Sales - Books\n\nContact Sales - Books\nSkip to main content\nUnfortunately we don't fully support your browser. If you have the option to, please upgrade to a newer version or use Mozilla Firefox, Microsoft Edge, Google Chrome, or Safari 14 or newer. If you are unable to, and need support, please send us your feedback.\nWe'd appreciate your feedback.Tell us what you think!\nAcademic & Government\nAcademic & Government\nHealth\nHealth\nIndustry\nIndustry\nElsevier Connect\nInsights\nAbout\nAbout\nCustomer support\nSupport\nPublish with us\nOpen Search\nLocation Selector\nmenu\nHome\nContact Sales - Books\nRequest a sales quote\nThank you for your interest in our products.\nFill out the required fields to request a sales quote.\nOur sales representative will share your request directly with your institution\u2019s decision makers, and together they will discuss the options of adding the publication to your institute\u2019s collection.\nTry the Institutional Ordering Platform\nInstitutional customers* can now purchase access to individual ScienceDirect books, including eBooks, Book Series, MRWs, Textbooks, and Handbooks via a self-service platform: no need for a sales representative and faster access.\nYou can learn more and place the order here.\n*Please note: US Federal Government, India-based customers and corporate customers cannot currently access the platform.\nFirst name *\nLast name *\nWork email address *\nWork phone *\nInstitution name *\nInstitution website *\nCountry / region *\nAfghanistan\u00c5land IslandsAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarticaAntigua and BarbudaArgentinaArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelgiumBeninBhutanBoliviaBosnia and HerzegovinaBotswanaBrazilVirgin Islands, BritishBrunei DarussalamBulgariaBurkina FasoBurundiCambodiaCameroonCanadaCabo VerdeCayman islandsChadChileChinaCoco IslandsColombiaCook IslandsCosta RicaCroatiaCubaCura\u00e7aoCyprusCzechiaCongo, Democratic RepublicDenmarkDjiboutiDominican RepublicEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEthiopiaFijiFinlandFranceGabonGambiaGeorgiaGermanyGhanaGibraltarGreeceGreenlandGrenadaGuatemalaGuineaGuyanaHaitiHeard Island and McDonald IslandsHondurasHong KongHungaryIcelandIndiaIndonesiaIranIraqIrelandIsle of ManIsraelItalyC\u00f4te d'IvoireJamaicaJapanJordanKazakhstanKenyaKorea, SouthKuwaitKyrgyzstanLatviaLebanonLesothoLiberiaLibyaLithuaniaLuxembourgNorth MacedoniaMadagascarMalawiMalaysiaMaldivesMaliMaltaMartiniqueMauritaniaMauritiusMexicoMoldovaMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNorfolk IslandKorea, NorthNorwayOmanPakistanPanamaPapua New GuineaParaguayPeruPhilippinesPolandPortugalPuerto RicoQatarCongoR\u00e9unionRomaniaRussian FederationRwandaSaint Kitts and NevisSaint LuciaSaint Vincent and the GrenadinesSamoaSaudi ArabiaSenegalSerbiaSeychellesSingaporeSint MaartenSlovakiaSloveniaSomaliaSouth AfricaSouth SudanSpainSri LankaSudanSurinameSvalbard and Jan MayenEswatiniSwedenSwitzerlandSyrian Arab RepublicTaiwanTajikistanTanzania, the United Republic ofThailandTogoTokelauTrinidad and TobagoTunisiaT\u00fcrkiyeUgandaUkraineUnited Arab EmiratesUnited KingdomUnited States of AmericaUnited States Minor Outlying IslandsUruguayVirgin Islands, U.S.UzbekistanVanuatuHoly SeeVenezuelaViet NamWallis and FutunaWestern SaharaYemenZambiaZimbabwe\nComments\nissn_isbn\nproduct\nWebApp_Label\nWebApp_Name\nCampaign_Name\nProduct 1 Level\nProduct 2 Level\nResponse_Type\nCommunication_Types\ndgcid\nreferrerURL\ncorrelationid\nIf you do not wish to receive updates, offers and other information about relevant products, services and events from Elsevier, please tick the box.\nCompany Division\nSubmit\nFooter navigation\nUseful links\nSubmit your paper\nShop Books & Journals\nOpen access\nView all products\nElsevier Connect\nAbout\nAbout Elsevier\nCareers\nGlobal Press Office\nAdvertising, reprints & supplements\nModern slavery act statement\nSupport\nCustomer support\nResource center\nGlobal | English\nCopyright \u00a9 2026 Elsevier, its licensors, and contributors. All rights are reserved, including those for text and data mining, AI training, and similar technologies.\nTerms & Conditions\nPrivacy policy\nAccessibility\nCookie settings", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/a0f2927f-bcb3-4ea7-9084-77f4caf54047", "content_hash": "113909aa156b90209709dfab886e40139011f9132b984961f3bd5973406aa1bc", "created_at": "2026-03-28T05:13:07.572687647Z"}
{"id": "4ec49ee1-473f-413d-91ae-a46319a600c5", "source": "brain", "text": "Fiche Montessori Mini Puzzle\n\nFiche Montessori Mini Puzzle\nSOLDES: -10% sur tout ! Avec le code DISCOUNT\nSOLDES: -10% sur tout ! Avec le code DISCOUNT\nMenu\nContact\nfr\nen\nhu\n0\nOK\nMon compte Connexion\n0 Panier (vide)\nVotre panier est vide\nCommander\nProduit ajout\u00e9 \u00e0 votre panier\nQuantit\u00e9 :\nIl y a 0 produits dans votre panier.\nIl y a 1 produit dans votre panier.\nTotal produits : 0,00 \u20ac\nLivraison : Gratuit\nTotal : 0,00 \u20ac\nContinuer mes achats\nCommander\nACCUEIL\nHygi\u00e8ne\nSavon naturel\nGel douche bio\nD\u00e9odorant naturel\nDentifrice naturel\nHygi\u00e8ne intime\nD\u00e9sinfectant\nCheveux\nShampoing naturel\nApr\u00e8s shampoing bio\nMasque capillaire bio\nHuile pour cheveux\nSoin capillaire\nAnti chute cheveux\nColoration capillaire naturelle\nAccessoire coiffure\nCoffret soin capillaire\nVisage\nNettoyant et d\u00e9maquillant\nMasque Visage\nGommage Visage\nSoin \u00e0 la bave d'escargot\nSoin anti-\u00e2ge\nSoin anti-imperfection\nSoin hydratant visage\nHuile visage\nS\u00e9rum visage\nContour des yeux\nBaume \u00e0 l\u00e8vres\nCr\u00e8me solaire bio\nAccessoire beaut\u00e9\nCoffret cadeau beaut\u00e9\nCorps\nLait & cr\u00e8me corps\nBeurre et baume corps\nHuile corps bio\nMasque pour le corps\nGommage corps\nSoin anti-vergetures\nSoin des mains et des ongles\nSoin des jambes et des pieds\nMassage\nAccessoire corps\nCoffret cadeau corps\nEpilation\nProduits aux oeufs de fourmis\nCire bio et naturelle\nAccessoire \u00e9pilation\nSoin apr\u00e8s \u00e9pilation\nCoffret \u00e9pilation\nMinceur\nG\u00e9lules minceur\nTh\u00e9 et Caf\u00e9 minceur\nSoin minceur et fermet\u00e9\nGaines et Corsets\nCoffret minceur\nMaquillage\nProduits teints\nCrayon sourcils\nProduits yeux\nProduits l\u00e8vres\nD\u00e9maquillant bio\nSoin des ongles\nAccessoire maquillage\nAroma & DIY\nHuiles Essentielles Bio\nHuiles v\u00e9g\u00e9tales\nPoudres V\u00e9g\u00e9tales\nArgiles\nTensioactifs\nMat\u00e9riel DIY\nActifs cosm\u00e9tiques\nAloe Vera\nEaux Florales\nBeurre\nBien-\u00eatre\nMassage et relaxation\nAphrodisiaque\nCompl\u00e9ment alimentaire\nAccessoires de sport\nAccessoires bien-\u00eatre\nBijoux\nBracelet\nBoucle d'oreille\nCollier\nBracelet de Cheville\nMINI PRIX\n- BLOG\n- PRO\nPromotions Nouveaut\u00e9s\nMenu\nAccueil\nBien-\u00eatre\nFiche Montessori Moiti\u00e9 d'animaux\nEnvoyer \u00e0 un ami\nEnvoyer \u00e0 un ami\nFiche Montessori Moiti\u00e9 d'animaux\nFiche \u00e9ducative inspiration montessori - Fiche moiti\u00e9 d'animaux - Trouver la moiti\u00e9 des animaux\nNom *\nE-mail *\n* Champs requis\nAnnuler\nEnvoyer\nRetirer ce produit de mes favoris\nAjouter ce produit \u00e0 mes favoris\nFiche Montessori Moiti\u00e9 d'animaux\n3,33 \u20ac\nOu payer en\nFiche \u00e9ducative inspiration montessori - Fiche moiti\u00e9 d'animaux - Trouver la moiti\u00e9 des animaux\nEn stock (10 produitproduits)\nDate de disponibilit\u00e9 :\nAjouter au panier\nLa quantit\u00e9 minimale pour pouvoir commander ce produit est 1\nPr\u00e9venez-moi lorsque le produit est disponible\nPartager\nNote\nLire les avis (0)\nDonnez votre avis\nPoint de fid\u00e9lit\u00e9 pour ce produit\n3 points de fid\u00e9lit\u00e9\nAvis (0)\nAucun avis n'a \u00e9t\u00e9 publi\u00e9 pour le moment.\nSoyez le premier \u00e0 donner votre avis\nDonnez votre avis\nFiche Montessori Moiti\u00e9 d'animaux\nFiche \u00e9ducative inspiration montessori - Fiche moiti\u00e9 d'animaux - Trouver la moiti\u00e9 des animaux\nTitre *\nCommentaire *\nVotre nom *\n* Champs requis\nAnnuler\nEnvoyer\nCommande par t\u00e9l\u00e9phone\nPrise de commandes par t\u00e9l\u00e9phone\nConseils & Astuces Beaut\u00e9\nRejoignez-nous sur notre groupe FB\nRestons en contact\nRejoignez-nous sur Instagram\nOffre Anniversaire\nUne super offre pour votre anniversaire\nLivraison rapide & gratuite\nEn France \u00e0 partir de 70 \u20ac d'achat\nEn mondial relais\nPaiement 100% s\u00e9curis\u00e9\nCB, Paypal, Ch\u00e8que, Virement\nPaiement en 4 fois sans frais !\nGarantie satisfaction\nSatisfait ou rembours\u00e9\nRetours accept\u00e9s pendant 14 jours\nService client au top\nPar t\u00e9l\u00e9phone : Mardi, Vendredi : 9H - 16H\nPar E-mail : 7J/7 24H/24\nCosmeto Nature, votre boutique de beaut\u00e9 au naturel. Elle propose \u00e0 la vente des produits et accessoires de beaut\u00e9 sur internet.\nInformations\nInformations\nLivraison & Retour\nPaiement S\u00e9curis\u00e9\nFAQ\nPlan du site\nNos produits\nNos produits\nPromotions\nNouveaut\u00e9s\nNos marques\nGagnez 5\u20ac en parrainant\nA propos\nA propos\nNotre histoire\nConditions g\u00e9n\u00e9rales\nMentions l\u00e9gales & CGU\nEspace Revendeur\nContactez-nous\nContactez-nous\n30 avenue du 8 mai 1945\n60180 Nogent Sur Oise\nFrance\n0745552249\n<EMAIL_18>\nMarchand approuv\u00e9 par la Soci\u00e9t\u00e9 des Avis Garantis, cliquez ici pour v\u00e9rifier l'attestation.\nWhataspp Live Chat\nSuivez-nous\nRecevez notre newsletter\nValider\nSuivez-nous\nCopyright \u00a9 2026 - Design by Wapcom.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/4ec49ee1-473f-413d-91ae-a46319a600c5", "content_hash": "d49b9b70722a20f28610469b0e30e062700064607d0a7449e9c41c87663a3c74", "created_at": "2026-03-28T05:13:07.465634692Z"}
{"id": "66afd4df-5115-43c7-8268-b1e60f337dcb", "source": "brain", "text": "Measles Vaccination | Measles (Rubeola) | CDC\n\nMeasles Vaccination | Measles (Rubeola) | CDC\nSkip directly to site content Skip directly to search\nAn official website of the United States government\nHere's how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.\nMeasles (Rubeola)\nExplore This Topic\nSearch\nSearch\nClear\nSearch\nFor Everyone\nAbout\nSymptoms and Complications\nHow It Spreads\nVaccination\nPlan for Travel\nCases and Outbreaks\nMeasles Resources\nView all\nHealth Care Providers\nClinical Overview\nVaccine Recommendations\nView all\nPublic Health\nFor Health Departments\nLab Testing\nBe Ready for Measles Toolkit\nView all\nRelated Topics:\nRubella\nHome\nsearch\nclear\nsearch\nMeasles (Rubeola)\nMenu\nclear\nsearch\nFor Everyone\nAbout\nSymptoms and Complications\nHow It Spreads\nVaccination\nPlan for Travel\nCases and Outbreaks\nMeasles Resources\nView All Home\nHealth Care Providers\nClinical Overview\nVaccine Recommendations\nView All\nPublic Health\nFor Health Departments\nLab Testing\nBe Ready for Measles Toolkit\nView All\nRelated Topics\nRubella\nMeasles (Rubeola)\nAbout Symptoms and Complications How It Spreads Vaccination Plan for Travel Cases and Outbreaks Measles Resources View Menu\nMeasles Vaccination\nJan. 17, 2025\nEspa\u00f1ol\nKey points\nTwo doses of the MMR vaccine are recommended by doctors as the best way to protect against measles, mumps, and rubella.\nChildren may get 2 doses of MMRV vaccine instead.\nMMR & MMRV vaccines usually protect people for life against measles and rubella; but immunity against mumps may decrease over time.\nIntroduction\nThe best way to protect against measles is to get the measles, mumps, and rubella (MMR) vaccine. Children may get the measles, mumps, rubella, and varicella (MMRV) vaccine instead, which protects against chickenpox too.\nMost people who are vaccinated with MMR & MMRV will be protected for life. Vaccines and high rates of vaccination have made these diseases much less common in the United States.\nAvailable vaccines\nThere are two vaccines that protect against measles, mumps, and rubella. Both MMR and MMRV vaccines may be given at the same time as other vaccines.\nMMR\nContains a combination of measles, mumps, and rubella vaccines.\nTwo MMR vaccines are available for use in the United States: M-M-R II and PRIORIX. Both are recommended similarly and considered interchangeable.\nMMRV\nContains a combination of measles, mumps, rubella, and varicella (chickenpox) vaccines.\nThis vaccine is only licensed for use in children who are 12 months through 12 years of age.\nRecommendations\nBoth MMR and MMRV vaccines may be given at the same time as other vaccines. Your healthcare provider can give you more information about each and which to get.\nMMR\nChildren need 2 doses of MMR vaccines:\n12\u201315 months old\n1st dose\n4\u20136 years old\n2nd dose\nOlder children, adolescents, & adults\u2014Also need 1 or 2 doses of MMR vaccine if they don't have evidence of immunity.A Doses should be separated at least 28 days apart.\nAnyone traveling internationally\u2014Should be fully vaccinated before traveling. Infants 6\u201311 months old should get 1 dose of the MMR vaccine before travel. Then they should get 2 more doses after their first birthday.\nPeople at increased risk for mumps during a mumps outbreak\u2014An additional dose of MMR may be needed. Public health authorities will notify you if you are at increased risk and should receive this extra dose. If you already have 2 doses of MMR, it's not necessary to seek out vaccination; unless the authorities tell you that you are part of this group.\nMeasles Vaccine Recommendations Summary\nRefer to this summary table to find the MMR recommendations based on age and status.\nDownload\nDownload\nKeep Reading MMR Recommendations Before International Travel\nMMRV\nChildren 12 months through 12 years of age may be given 2 doses of MMRV vaccine. Each dose is usually given at:\n12\u201315 months old\n1st dose\n4\u20136 years old\n2nd dose (can also be given 3 months after 1st dose)\nAfter exposure to measles, mumps, or rubella\nIf you don't have immunityA against these diseases and become exposed to them, talk with your doctor about getting MMR vaccine. It is not harmful to get MMR vaccine after being exposed to measles, mumps, or rubella. Doing so may possibly prevent later disease.\nIf you get MMR vaccine within 72 hours of initially being exposed to measles, you may get some protection; or have milder illness. In other cases, you may be given a medicine called immunoglobulin (IG) within 6 days of being exposed to measles. This provides some protection against the disease or illness is milder.\nUnlike with measles, MMR has not been shown to be effective at preventing mumps or rubella in people already infected.\nWhy getting vaccinated is important\nThe MMR vaccine protects your child from measles, mumps, and rubella, potentially serious diseases caused by viruses. Almost everyone who has not had the MMR vaccine will get sick if they are exposed to those viruses. The vaccine keeps your child from missing school or childcare; and you from missing work to care for your sick child. Vaccination also limits the size, duration, and spread of outbreaks.\nFor measles: MMR vaccine protects your child from getting an uncomfortable rash and high fever from measles.\nFor mumps: MMR vaccine protects your child from getting a fever and swollen glands under the ears or jaw from mumps.\nFor rubella: MMR vaccine prevents your child from getting a rash and fever from rubella. The vaccine also prevents your child from spreading rubella to a pregnant woman whose unborn baby could develop serious birth defects or die if the mother gets rubella.\nWho should get vaccinated\nMMR vaccination is important for children as well as adults who do not have evidence of immunity.A These include:\nStudents at post-high school educational institutions\nHealthcare personnel\nInternational travelers\nWomen of childbearing age before they get pregnant\nGroups at increased risk for mumps because of a mumps outbreak\nWho shouldn't get vaccinated\nSome people should not get the MMR vaccine, or they should wait. People should check with their healthcare provider about whether they should get the vaccine if they:\nHas had an allergic reaction after a previous dose of MMR or MMRV vaccine, or has any severe, life-threatening allergies.\nAre or may be pregnant. Wait to get MMR vaccine until after you are no longer pregnant. Avoid getting pregnant for at least 1 month after getting MMR vaccine.\nHave a weakened immune system due to disease or medical treatments; or have a family member with a history of immune system problems.\nHave ever had a condition that makes them bruise or bleed easily.\nHave recently had a blood transfusion or received other blood products. You might be advised to postpone MMR vaccination for 3 months or more.\nHave tuberculosis.\nHave gotten any other vaccines in the past 4 weeks.\nAre feeling unwell or severely ill. Your doctor can advise you.\nAdditionally, people should wait to get the MMRV vaccine and tell their provider if they:\nHave a history of seizures, or has a parent, brother, or sister with a history of seizures.\nAre taking or plans to take salicylates (such as aspirin).\nThe vaccine is safe and effective\nMMR vaccine is very safe and is effective at preventing measles, mumps, and rubella. Vaccines, like any medicine, can have side effects. These are usually mild and go away on their own.\nThere is no link between the MMR vaccine and autism. Scientists in the United States and other countries have carefully studied the MMR vaccine. None has found a link between autism and the MMR vaccine.\nIt is safe for breastfeeding women to receive MMR vaccination. Breastfeeding does not interfere with the response to MMR vaccine; and the baby will not be affected by the vaccine through breast milk.\nOne dose of MMR vaccine is:\n93% effective again", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/66afd4df-5115-43c7-8268-b1e60f337dcb", "content_hash": "767a27a4c5b4e7d6ffa7b88601044ec601f9029564dafa5577eb46c22d274a35", "created_at": "2026-03-28T05:13:07.375276232Z"}
{"id": "56398a88-1e46-45c2-8909-a29b313b566a", "source": "brain", "text": "\u6625\u7bc0\u671f\u9593\u570b\u5916\u65c5\u904a\u83ab\u5fd8\u5148\u81f3\u65c5\u904a\u91ab\u5b78\u9580\u8a3a\u8aee\u8a62\uff1b\u5165\u5883\u6709\u75c7\u72c0\u4e3b\u52d5\u901a\u5831\u6a5f\u5834\u6aa2\u75ab\u7ad9\uff1b\u8fd4\u570b\u5f8c\u4e0d\u9069\u901f\u5c31\u91ab - Taiwan Centers for Disease Control\n\n\u6625\u7bc0\u671f\u9593\u570b\u5916\u65c5\u904a\u83ab\u5fd8\u5148\u81f3\u65c5\u904a\u91ab\u5b78\u9580\u8a3a\u8aee\u8a62\uff1b\u5165\u5883\u6709\u75c7\u72c0\u4e3b\u52d5\u901a\u5831\u6a5f\u5834\u6aa2\u75ab\u7ad9\uff1b\u8fd4\u570b\u5f8c\u4e0d\u9069\u901f\u5c31\u91ab - Taiwan Centers for Disease Control\n\"Your browser does not support JavaScript. If the webpage function is not working properly, please enable the browser JavaScript status.\"\nCenter block ALT+C\n\u4e2d\n:::\nHome\n\u4e2d\u6587\u7248\nSitemap\nRSS\nTotal station search\nAbout CDC\nAbout CDC\nPolicies\nNHCC\nActs and Regulations\nPublications\nDiseases & Conditions\nImportant Diseases\nTravelers\u2019 Health\nQuarantine\nTravel Health Notices\nForeigners\u2019 Health\nInfection Control and Biosafety\nVaccine-Preventable Diseases Control\nPrograms & Campaigns\nResearch & Development\nEnd TB Special Project\nPreparedness and Response\nField Epidemiology Training Program\nResearch Reports\nInternship(training) Programs Guidelines\nData & Statistics\nTaiwan National Infectious Disease Statistics System\nStatistics of HIV/AIDS\nDisease Surveillance Express\nInfluenza Express\nNational Notifiable Disease Surveillance Report\nWeekly Report of Enterovirus Infection\nTaiwan Healthcare-associated infection and Antimicrobial resistance Surveillance System\nTaiwan CDC Open Data Portal\nInternational Cooperation\nTaiwan IHR National Focal Point Contact Information\nInternational Cooperation\nInternational Conference\nAPEC Related Events\nForeign Visitors\nRelative Resources\nSchool Visits\nHome\n\u50b3\u67d3\u75c5\u8207\u9632\u75ab\u5c08\u984c\n\u50b3\u67d3\u75c5\u4ecb\u7d39\n\u7b2c\u4e8c\u985e\u6cd5\u5b9a\u50b3\u67d3\u75c5\n\u767b\u9769\u71b1\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u65b0\u805e\u7a3f\n\u767b\u9769\u71b1\n\u767b\u9769\u71b1\n\u75be\u75c5\u4ecb\u7d39\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u65b0\u805e\u7a3f\n\u81f4\u91ab\u754c\u901a\u51fd\n\u767b\u9769\u71b1\u6d41\u884c\u5340(NS1\u5feb\u7be9\u5373\u78ba\u8a3a)\n\u767b\u9769\u71b1\u611f\u67d3\u98a8\u96aa\u570b\u5bb6\n\u767b\u9769\u71b1\u5730\u5716\uff08\u5efa\u8b70\u4f7f\u7528Chrome\u700f\u89bd\u5668\u64cd\u4f5c\uff09\n\u7d71\u8a08\u8cc7\u6599\u67e5\u8a62\n\u570b\u969b\u91cd\u8981\u75ab\u60c5\n\u570b\u969b\u9593\u65c5\u904a\u75ab\u60c5\u5efa\u8b70\u7b49\u7d1a\u8868\n\u75c5\u5a92\u868a\u9ad8\u98a8\u96aa\u5730\u5340\n\u91cd\u8981\u6307\u5f15\u53ca\u6559\u6750\n\u6cbb\u7642\u7167\u8b77\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u81fa\u7063\u5730\u5340\u57c3\u53ca\u6591\u868a\u5206\u5e03\u9109\u93ae\u73fe\u6cc1\n\u6591\u868a\u85e5\u6548\u8a66\u9a57\u7d50\u679c\n\u75c5\u5a92\u868a\u5bc6\u5ea6\u8abf\u67e5\n\u5ba3\u5c0e\u7d20\u6750\n\u5ba3\u5c0e\u7d20\u6750\n\u5ba3\u5c0e\u7d20\u6750\n\u591a\u5a92\u9ad4\n\u6d77\u5831\n\u55ae\u5f35\n\u624b\u518a\n\u5ee3\u64ad\n\u5176\u4ed6\n\u7814\u7a76\u51fa\u7248\n\u7814\u7a76\u51fa\u7248\n\u7814\u7a76\u51fa\u7248\n\u6b77\u5e74\u7814\u7a76\u8a08\u756b\n\u5716\u66f8\n\u75ab\u60c5\u5831\u5c0e\nQ&A\nQ&A\nQ&A\n\u57fa\u790e\u7bc7\n\u9632\u868a\u7bc7\n\u9632\u75ab\u7bc7\n\u5c31\u91ab\u6cbb\u7642\u7bc7\n\u6625\u7bc0\u671f\u9593\u570b\u5916\u65c5\u904a\u83ab\u5fd8\u5148\u81f3\u65c5\u904a\u91ab\u5b78\u9580\u8a3a\u8aee\u8a62\uff1b\u5165\u5883\u6709\u75c7\u72c0\u4e3b\u52d5\u901a\u5831\u6a5f\u5834\u6aa2\u75ab\u7ad9\uff1b\u8fd4\u570b\u5f8c\u4e0d\u9069\u901f\u5c31\u91ab\nFacebook Line Print\nBack\n( alt + \u2190 Back)\n\u6642\u503c\u5bd2\u5047\u53ca\u6625\u7bc0\u65c5\u904a\u65fa\u5b63\uff0c\u70ba\u907f\u514d\u50b3\u67d3\u75c5\u6563\u5e03\uff0c\u9632\u75ab\u4eba\u54e1\u6625\u7bc0\u671f\u9593\u4e0d\u9b06\u61c8\uff0c\u6301\u7e8c\u99d0\u5b88\u5728\u5404\u500b\u6a5f\u5834\u6e2f\u57e0\u5be6\u65bd\u6aa2\u75ab\uff0c\u89e3\u6c7a\u6c11\u773e\u5404\u9805\u9632\u75ab\u9700\u6c42\u3002\u75be\u75c5\u7ba1\u5236\u7f72\u547c\u7c72\uff0c\u6c11\u773e\u51fa\u570b\u524d\u61c9\u5148\u66b8\u89e3\u7576\u5730\u75ab\u60c5\uff0c\u524d\u5f80\u7684\u570b\u5bb6\u5982\u9700\u4f7f\u7528\u7627\u75be\u9810\u9632\u85e5\u7269\u6216\u63a5\u7a2e\u75ab\u82d7\uff0c\u61c9\u65bc\u51fa\u767c\u524d4\u9031\u5148\u81f3\u570b\u516726\u5bb6\u65c5\u904a\u91ab\u5b78\u9580\u8a3a\u5408\u7d04\u91ab\u9662\u5c0b\u6c42\u5c08\u696d\u65c5\u904a\u91ab\u7642\u8aee\u8a62\uff1b\u7531\u65bc\u6625\u7bc0\u671f\u9593\u91ab\u9662\u591a\u66ab\u505c\u9580\u8a3a\u670d\u52d9\uff0c\u8acb\u898f\u5283\u65bc\u5e74\u5f8c\u51fa\u570b\u7684\u65c5\u5ba2\u63d0\u65e9\u5c31\u8a3a\u8aee\u8a62\uff0c\u4fdd\u969c\u65c5\u9014\u5065\u5eb7\u3002\n\u4f9d\u64da\u75be\u7ba1\u7f72\u570b\u969b\u75ab\u60c5\u76e3\u6e2c\u986f\u793a\uff0c\u5317\u534a\u7403\u6574\u9ad4\u6d41\u611f\u75ab\u60c5\u4e0a\u5347\uff0c\u8fd1\u671f\u6d41\u884c\u75c5\u6bd2\u4ee5H3N2\u578b\u70ba\u4e3b\u3002\u4e2d\u570b\u5927\u9678\u3001\u82f1\u570b\u3001\u97d3\u570b\u53ca\u65e5\u672c\u7b49\u570b\u5bb6\u5c1a\u8655\u8afe\u7f85\u75c5\u6bd2\u6d41\u884c\u671f\u4e14\u6025\u6027\u8178\u80c3\u708e\u75c5\u4f8b\u4ecd\u591a\u3002\u6771\u5357\u4e9e\u3001\u5357\u4e9e\u3001\u4e2d\u5357\u7f8e\u6d32\u66a8\u52a0\u52d2\u6bd4\u6d77\u5730\u5340\u3001\u975e\u6d32\u7b49\u70ba\u767b\u9769\u71b1\u3001\u7627\u75be\u3001\u5c48\u516c\u75c5\u53ca\u8332\u5361\u75c5\u6bd2\u611f\u67d3\u75c7\u7b49\u87f2\u5a92\u50b3\u67d3\u75c5\u6d41\u884c\u5730\u5340\uff0c\u7f8e\u570b\u4f5b\u5dde\u53ca\u5fb7\u5dde\u4ea6\u6709\u96f6\u661f\u8332\u5361\u672c\u571f\u75ab\u60c5\uff1b\u53e6\u5df4\u897f\u9ec3\u71b1\u75c5\u75ab\u60c5\u6301\u7e8c\u53ca\u5b89\u54e5\u62c9\u51fa\u73fe\u8332\u5361\u672c\u571f\u75c5\u4f8b\uff0c\u57fa\u65bc\u7576\u5730\u5177\u66b4\u9732\u98a8\u96aa\uff0c\u5206\u5225\u63d0\u5347\u65c5\u904a\u75ab\u60c5\u5efa\u8b70\u81f3\u6ce8\u610f\u53ca\u8b66\u793a\u3002\u6492\u54c8\u62c9\u6c99\u6f20\u4ee5\u5357\u4e4b\u975e\u6d32\u4e2d\u90e8\u5730\u5340\u6b63\u503c\u6d41\u884c\u6027\u8166\u810a\u9ad3\u819c\u708e\u6d41\u884c\u671f\u3002\u6c99\u70cf\u5730\u963f\u62c9\u4f2f\u7b49\u4e2d\u6771\u570b\u5bb6\uff0c\u5168\u5e74\u5747\u6709\u6563\u767cMERS\u75ab\u60c5\u98a8\u96aa\uff1b\u963f\u5bcc\u6c57\u53ca\u5df4\u57fa\u65af\u5766\u4ecd\u6709\u5c0f\u5152\u9ebb\u75fa\u75c5\u4f8b\u767c\u751f\u3002\n\u53e6\u75be\u7ba1\u7f72\u63a5\u7372\u9678\u65b9\u901a\u5831\uff0c1\u67081\u65e5\u81f31\u670815\u65e5\u65b0\u589e95\u4f8bH7N9\u6d41\u611f\u75c5\u4f8b\uff0c\u767c\u75c5\u65e5\u4ecb\u65bc12\u670813\u65e5\u81f31\u670813\u65e5\uff0c\u5206\u5225\u70ba\u6c5f\u8607\u770132\u4f8b\u3001\u6d59\u6c5f\u770122\u4f8b\u3001\u5b89\u5fbd\u770114\u4f8b\u3001\u6e56\u5357\u770111\u4f8b\u3001\u5ee3\u6771\u77018\u4f8b\u3001\u6c5f\u897f\u7701\u53ca\u798f\u5efa\u7701\u54044\u4f8b\uff1b\u500b\u6848\u591a\u5177\u79bd\u985e\u3001\u6d3b\u79bd\u5e02\u5834\u66b4\u9732\u53f2\u3002\u81ea\u5165\u79cb\uff082016\u5e7410\u67081\u65e5\uff09\u8fc4\u4eca\u7d2f\u8a08240\u4f8b\uff0c\u4ee5\u6c5f\u8607\u770191\u4f8b\u3001\u6d59\u6c5f\u770145\u4f8b\u3001\u5b89\u5fbd\u770128\u4f8b\u3001\u5ee3\u6771\u770126\u4f8b\u70ba\u591a\u3002\u4e2d\u570b\u5927\u9678\u5f80\u5e7411\u6708\u81f3\u6b21\u5e745\u6708\u70ba\u6d41\u884c\u5b63\uff0c\u672c\u5b6312\u6708\u53ca1\u6708\u75c5\u4f8b\u5feb\u901f\u6500\u5347\uff0c\u76ee\u524d\u75c5\u4f8b\u6578\u5df2\u70ba\u6b77\u5e74\u540c\u671f\u6700\u9ad8\u3002\n\u76ee\u524d\u91dd\u5c0d\u4eba\u985e\u65b0\u578bA\u578b\u6d41\u611f\u65c5\u904a\u75ab\u60c5\u5efa\u8b70\uff0c\u4e2d\u570b\u5927\u9678\u6c5f\u8607\u7701\u3001\u6d59\u6c5f\u7701\u3001\u5b89\u5fbd\u7701\u3001\u5ee3\u6771\u7701\u3001\u798f\u5efa\u7701\u3001\u8cb4\u5dde\u7701\u3001\u4e0a\u6d77\u5e02\u3001\u6e56\u5317\u7701\u3001\u6e56\u5357\u7701\u3001\u6cb3\u5357\u7701\u3001\u6c5f\u897f\u7701\u3001\u5c71\u6771\u7701\u3001\u5ee3\u897f\u58ef\u65cf\u81ea\u6cbb\u5340\u3001\u56db\u5ddd\u7701\u3001\u6cb3\u5317\u7701\u3001\u5317\u4eac\u5e02\u3001\u5929\u6d25\u5e02\u3001\u907c\u5be7\u7701\u53ca\u96f2\u5357\u7701\u65c5\u904a\u75ab\u60c5\u5efa\u8b70\u5217\u70ba\u7b2c\u4e8c\u7d1a\uff1a\u8b66\u793a\uff08Alert\uff09\uff0c\u5176\u4ed6\u7701\u5e02\uff08\u4e0d\u542b\u6e2f\u6fb3\uff09\u5217\u70ba\u7b2c\u4e00\u7d1a\uff1a\u6ce8\u610f\uff08Watch\uff09\u3002\n\u75be\u7ba1\u7f72\u63d0\u9192\uff0c\u6c11\u773e\u65c5\u904a\u671f\u9593\uff0c\u8acb\u9075\u5faa\u300c\u52e4\u6d17\u624b\u3001\u5403\u719f\u98df\u3001\u559d\u74f6\u88dd\u6c34\u300d\u3001\u300c\u843d\u5be6\u9632\u868a\u63aa\u65bd\u300d\u53ca\u300c\u4e0d\u63a5\u89f8\u79bd\u9ce5\u3001\u72ac\u8c93\u53ca\u91ce\u751f\u52d5\u7269\u300d\u7b49\u57fa\u672c\u9810\u9632\u63aa\u65bd\u3002\u5982\u51fa\u73fe\u767c\u71d2\u3001\u8179\u7009\u3001\u51fa\u75b9\u3001\u54b3\u55fd\u7b49\u7591\u4f3c\u50b3\u67d3\u75c5\u75c7\u72c0\uff0c\u8acb\u65bc\u5165\u5883\u6642\u4e3b\u52d5\u544a\u77e5\u6aa2\u75ab\u4eba\u54e1\uff0c\u4ee5\u5373\u6642\u7372\u5f97\u9069\u5207\u7684\u7167\u8b77\u8655\u7f6e\u3002\u8fd4\u570b\u5f8c21\u5929\u5167\u51fa\u73fe\u4e0d\u9069\uff0c\u61c9\u5118\u901f\u5c31\u91ab\uff0c\u4e26\u4e3b\u52d5\u544a\u77e5\u91ab\u5e2b\u8fd1\u671f\u65c5\u904a\u53f2\u3002\u76f8\u95dc\u8cc7\u8a0a\u53ef\u81f3\u75be\u7ba1\u7f72\u5168\u7403\u8cc7\u8a0a\u7db2\u300c\u570b\u969b\u65c5\u904a\u8207\u5065\u5eb7\u5c08\u5340\u300d\uff08https://www.cdc.gov.tw/Category/List/dFJicFhwWk03RU8zK2RrYzRSWVp1UT09\uff09\uff0c\u6216\u64a5\u6253\u514d\u4ed8\u8cbb\u9632\u75ab\u5c08\u7dda1922\uff08\u62160800-001922\uff09\u6d3d\u8a62\u3002\nPublishTime 2017/1/23\n:::\nSitemap\nAbout CDC\nAbout CDC\nPolicies\nNHCC\nActs and Regulations\nPublications\nDiseases & Conditions\nImportant Diseases\nTravelers\u2019 Health\nQuarantine\nTravel Health Notices\nForeigners\u2019 Health\nInfection Control and Biosafety\nVaccine-Preventable Diseases Control\nPrograms & Campaigns\nResearch & Development\nEnd TB Special Project\nPreparedness and Response\nField Epidemiology Training Program\nResearch Reports\nInternship(training) Programs Guidelines\nData & Statistics\nTaiwan National Infectious Disease Statistics System\nStatistics of HIV/AIDS\nDisease Surveillance Express\nInfluenza Express\nNational Notifiable Disease Surveillance Report\nWeekly Report of Enterovirus Infection\nTaiwan Healthcare-associated infection and Antimicrobial resistance Surveillance System\nTaiwan CDC Open Data Portal\nInternational Cooperation\nTaiwan IHR National Focal Point Contact Information\nInternational Cooperation\nInternational Conference\nAPEC Related Events\nForeign Visitors\nRelative Resources\nSchool Visits\nNews\nPress Releases\nEvents\nCurrent Topics\nPrivacy Policy\nSecurity Policy\nGovernment Website Open Information Announcement\nDirector-mail\nCopyright Notice on Health Educational Materials\nTaiwan Centers for Disease Control\nNo.6, Linsen S. Rd., Jhongjheng District, Taipei City 100008, Taiwan (R.O.C.) MAP\nTEL\uff1a886-2-2395-9825\nCopyright \u00a9 2026 Taiwan Centers for Disease Control. All rights reserved.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/56398a88-1e46-45c2-8909-a29b313b566a", "content_hash": "911159976bb9ede87bd1f2d4f28bbdd0fb8cc3b06a91fe9a823ae2949e45b63a", "created_at": "2026-03-28T05:13:07.262412053Z"}
{"id": "fe7ec651-29b3-416e-9fbb-c33d52d7453c", "source": "brain", "text": "NLM Support Center \u00b7 NLM Customer Support Center\n\nNLM Support Center \u00b7 NLM Customer Support Center\nYou\u2019re offline. This is a read only version of the page.\nToggle navigation\nNational Library of Medicine\nNational Library of Medicine\nSupport Center Home\nHome\nBrowse Help Topics\nSearch\nMost popular articles\nHow do I obtain the full text of an article?\nHow do I cite NCBI services and databases?\nWhat is a Material Safety Data Sheet (MSDS)?\nWhy do I get error messages when I try to annotate a coding region (CDS) in BankIt?\nWhere can I find information about my health insurance?\nMost recent articles\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nDec 9, 2025\nCan a publisher submit a manuscript to NIHMS for inclusion in PubMed Central on my behalf?\nDec 9, 2025\nWhen will a PMCID be assigned to an NIHMS manuscript?\nOct 8, 2025\nWill a search check my spelling?\nOct 8, 2025\nWhen is required clinical trial results information due?\nTop rated articles\nAug 27, 2025\nWhat are genome assembly accession numbers at NCBI?\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nNov 12, 2019\nHow do I know which Routing Method to use?\nMar 21, 2018\nHow are SNOMED CT files organized?\nNov 20, 2019\nHow do I see the routing history for my Borrow request?\nHealth Literature Drugs & Medical Devices About NLM & NIH My NCBI/Accounts BLAST Submit Data Genes & Genomes ClinicalTrials.gov Getting NLM Data Grants & Funding History of Medicine\nWrite to the help desk\nThe Knowledge Base contains numerous support references, created by our support professionals who have resolved issues for our customers. It is constantly updated, expanded, and refined to ensure that you have access to the very latest information.\n\u200bConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fe7ec651-29b3-416e-9fbb-c33d52d7453c", "content_hash": "fb1cfe8a4b8f262d7c470e771dd735e46402178ec219bf148d3c1b8d730146ec", "created_at": "2026-03-28T05:13:07.093646084Z"}
{"id": "3b2df12c-5dc3-447e-989b-dd5b7fa3b9dc", "source": "brain", "text": "Mid-Career Library and Information Professionals - 1st Edition | Elsevier Shop\n\nMid-Career Library and Information Professionals - 1st Edition | Elsevier Shop\nSkip to main content\nBooks\nJournals\nBrowse by subject\nBack\nDiscover Books & Journals by subject\nLife Sciences\nAgricultural & Biological Sciences\nDrug Discovery\nImmunology\nLife Sciences\nMicrobiology & Virology\nNeuroscience\nPharmaceutical Sciences\nPharmacology\nToxicology\nAll\nPhysical Sciences & Engineering\nAstronomy, Astrophysics, Space Science\nBuilt Environment\nChemical Engineering\nChemistry\nComputer Science\nEarth & Planetary Sciences\nEnergy & Power\nEngineering & Technology\nEnvironmental Sciences\nMathematics\nMaterials Science\nPhysics\nAll\nSocial Sciences & Humanities\nArts & Humanities\nBusiness, Management & Accounting\nDecision Sciences\nEconomics & Finance\nForensics\nPsychology\nSocial Sciences\nAll\nHealth\nDentistry\nHealth Professions\nMedicine\nNursing & Midwifery\nVeterinary Science & Veterinary Medicine\nAll\nSearch\nView Cart\nMy account\nOpen main site navigation\nHome\nBooks\nSubjects\nSocial sciences\nMid-Career Library and Information Professionals\nMid-Career Library and Information Professionals\nA Leadership Primer\n1st Edition - December 14, 2010\nLatest edition\nEditors: Dawn Lowe-Wincentsen, Linda Crook\nLanguage: English\nAs librarians move into the middle of their careers, they are more ready than ever to take on new leadership opportunities. Literature on leadership is expanding in the field of\u2026 Read more\nDescription\nAs librarians move into the middle of their careers, they are more ready than ever to take on new leadership opportunities. Literature on leadership is expanding in the field of library and information sciences, and more and more seminars and workshops are being offered for new and seasoned leaders. This book asks the questions: \u2018What about us?\u2019 and, \u2018Where is the leadership advice and training for those who are no longer new librarians, but are also not yet seasoned leaders?\u2019 The title illustrates how to work the middle, from being in the sophomore slump progressing to the next leaders in the field, to look for perspectives from others who are in the middle of their career, and how they have developed into leaders, ways to develop one\u2019s own style of leadership and grow one\u2019s career and future as a librarian and information professional.\nKey features\nPerspectives on leadership from mid-career information professionals\nTips and tools on how to become a leader from the middle of your career\nA how-to guide on making changes from the middle\nReadership\nPractitioners of Library and Information Science\nTable of contents\nSaying yes, again: An introduction to leadership for mid-career librarians; What to do when you can\u2019t do it all; Empowering the reluctant new library manager; Stuck in the middle and loving it! Why middle managers have the ability to lead from the heart and the power to persuade; Making it work: Leading without a pedestal; Leading without authority: Maintaining balance and relationships; Career progression: Mentoring to the rescue; When life and leadership collide; Avoiding the Peter Principle: \u2018Every employee tends to rise to his level of incompetence\u2019; Work envy, workhorses and the mid-career librarian; Don\u2019t get stuck in a rut!; Out of bounds: Developing a library outreach program using the \u2018Five Practices of Exemplary Leadership\u2019 model; Technologically indispensable: Leading when you\u2019re technically competent but seen merely as a useful tool to get other folks\u2019 ideas implemented; Same song, different verse: critical followership as an act of resilience for second-career librarians; New in town: Leadership betwixt and between; Making your mark: Scholarship, \u2018niche-building,\u2019 and other ways of defining and marketing your expertise; Exercise your leadership potential.\nReview quotes\n\"\u2026a very current, topical and easy-to-read book that is perfect for the busy librarian. \u2026a valuable addition to a professional library for a librarian seeking career advancement or looking for new work challenges.\"\u2014Australian Library Journal\n\"One of the book's strengths is that it is written by librarians with a wide breadth of experiences. They provide useful references for further reading, and many of them make effective use of tables to convey key points. The book's format, length and price are reasonable.\"\u2014Journal of the Canadian Health Libraries Association\nProduct details\nEdition: 1\nLatest edition\nPublished: December 14, 2010\nLanguage: English\nAbout the editors\nDL\nDawn Lowe-Wincentsen\nDawn Lowe-Wincentsen is the Portland Operations librarian at the Oregon Institute of Technology. She graduated with her MLIS from Louisiana State University in 2003, though she has been in libraries in various forms since her first job as a student assistant in the library at Linfield College in 1996. Dawn has written other various works including co-authoring A Leadership Primer for New Librarians: Tools for Helping Today's Early Career Librarians Become Tomorrow's Library Leaders (2009).\nAffiliations and expertise\nWilsonville Campus Librarian, Oregon Institute of Technology, Portland, OR, USA\nLC\nLinda Crook\nLinda Crook is Science Librarian and Assistant Professor at Washington State University, where she is the liaison to the College of Pharmacy. She received her MLIS from the University of Washington iSchool in 2000. She has been working in libraries since 1991, including time as student assistant, paraprofessional, and librarian; in a public library, a special library, and academic libraries; as lead, supervisor, division head, and branch library head. Linda is active in the American Library Association where she participated in the 2008 Emerging Leaders program. Her other works include a contribution to A Leadership Primer for New Librarians: Tools for Helping Today's Early Career Librarians Become Tomorrow's Library Leaders (2009).\nAffiliations and expertise\nWashington State University, USA\nView book on ScienceDirect\nRead Mid-Career Library and Information Professionals on ScienceDirect\nproduct\nUseful links\nBook awards\nBook bestsellers\nBook imprints\nBook series(opens in new tab/window)\nFlexible eBook solutions\nNew book releases\nUpcoming book releases\nQuick help\neBook format help(opens in new tab/window)\nMy account(opens in new tab/window)\nReturns & refunds(opens in new tab/window)\nShipping & delivery(opens in new tab/window)\nSubscriptions & renewals(opens in new tab/window)\nSupport & contact(opens in new tab/window)\nTax exempt orders(opens in new tab/window)\nSolutions\nClinicalKey(opens in new tab/window)\nClinicalKey AI(opens in new tab/window)\nEmbase(opens in new tab/window)\nEvolve(opens in new tab/window)\nMendeley(opens in new tab/window)\nKnovel(opens in new tab/window)\nReaxys(opens in new tab/window)\nScienceDirect(opens in new tab/window)\nAbout\nAbout Elsevier(opens in new tab/window)\nCareers(opens in new tab/window)\nNewsroom(opens in new tab/window)\n(opens in new tab/window)(opens in new tab/window)(opens in new tab/window)(opens in new tab/window)\nCopyright \u00a9 2026 Elsevier, its licensors, and contributors. All rights are reserved, including those for text and data mining, AI training, and similar technologies.\nTerms & conditions(opens in new tab/window)\nPrivacy policy(opens in new tab/window)\nAccessibility(opens in new tab/window)\nCookie Settings\nSupport & contact(opens in new tab/window)", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/3b2df12c-5dc3-447e-989b-dd5b7fa3b9dc", "content_hash": "d6f9ed7b95a3bd5510bf0aec7b5deedc8588e70ec591ba97dde4697d5806442c", "created_at": "2026-03-28T05:13:06.982686563Z"}
{"id": "4d1e1378-2480-4c0c-9537-78a856dba1f8", "source": "brain", "text": "Antibiotic Resistant Salmonella - Search Results - PubMed\n\nAntibiotic Resistant Salmonella - Search Results - PubMed\nThis site needs JavaScript to work properly. Please enable it to take advantage of the complete set of features!\nClipboard, Search History, and several other advanced features are temporarily unavailable.\nSkip to main page content\nAn official website of the United States government\nHere's how you know\nThe .gov means it\u2019s official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you\u2019re on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard\nPublications\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nSearch Page\nSearch:\nSearch\nAdvanced Create alert Create RSS Clipboard\nUser Guide\nFilters 0\nTimeline\nSort by: Best match Most recent Publication date First author Journal\nDisplay options\nDisplay options\nFormat Summary Abstract PubMed PMID\nPer page 10 20 50 100 200\nAbstract snippets\nShow\nHide\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nSave citations to file\nSelection: All results on this page All results Selection\nFormat: Summary (text) PubMed PMID Abstract (text) CSV\nCreate file\nCancel\nEmail citations\nEmail address has not been verified. Go to My NCBI account settings to confirm your email and then refresh this page.\nTo:\nSubject:\nBody:\nSelection: All results on this page All results Selection\nFormat: Summary Summary (text) Abstract Abstract (text)\nMeSH and other data\nSend email\nCancel\nSend citations to clipboard\nSelection: All results on this page All results Selection\nSend\nCancel\nAdd to Collections\nSelection: All results on this page All results Selection\nCreate a new collection\nAdd to an existing collection\nName your collection:\nName must be less than 100 characters\nChoose a collection:\nUnable to load your collection due to an error\nPlease try again\nAdd\nCancel\nAdd to My Bibliography\nSelection: All results on this page All results Selection\nMy Bibliography\nUnable to load your delegates due to an error\nPlease try again\nAdd\nCancel\nCreate a file for external citation management software\nSelection: All results on this page All results Selection\nCreate file\nCancel\nYour saved search\nName of saved search:\nSearch terms:\nAntibiotic Resistant Salmonella\nTest search terms\nWould you like email updates of new search results?\nSaved Search Alert Radio Buttons\nYes\nNo\nEmail: (change)\nFrequency: Monthly Weekly Daily\nWhich day? The first Sunday The first Monday The first Tuesday The first Wednesday The first Thursday The first Friday The first Saturday The first day The first weekday\nWhich day? Sunday Monday Tuesday Wednesday Thursday Friday Saturday\nReport format: Summary Summary (text) Abstract Abstract (text) PubMed\nSend at most: 1 item 5 items 10 items 20 items 50 items 100 items 200 items\nSend even when there aren't any new results\nOptional text in email:\nSave\nCancel\nYour RSS Feed\nName of RSS Feed:\nNumber of items displayed: 5 10 15 20 50 100\nCreate RSS\nCancel\nRSS Link\nCopy\nFilters\nMy Custom Filters\nResults by year\nExpand/collapse timeline\nReset\nTable representation of search results timeline featuring number of search results per year.\nYear\nNumber of Results\n1947 1\n1949 1\n1950 6\n1951 9\n1952 7\n1953 8\n1954 13\n1955 6\n1956 1\n1957 5\n1958 6\n1959 3\n1960 5\n1961 11\n1962 15\n1963 32\n1964 51\n1965 33\n1966 30\n1967 48\n1968 55\n1969 78\n1970 64\n1971 76\n1972 76\n1973 76\n1974 91\n1975 98\n1976 85\n1977 88\n1978 82\n1979 92\n1980 73\n1981 84\n1982 89\n1983 81\n1984 83\n1985 73\n1986 97\n1987 88\n1988 58\n1989 72\n1990 93\n1991 99\n<PHONE_8> 100\n1994 77\n1995 82\n<PHONE_9> 100\n<PHONE_10> 127\n2000 179\n2001 154\n2002 174\n2003 170\n2004 219\n2005 241\n2006 263\n2007 272\n2008 264\n2009 280\n2010 286\n2011 324\n2012 328\n2013 351\n2014 396\n2015 398\n2016 440\n2017 430\n2018 514\n2019 574\n2020 674\n2021 745\n2022 775\n2023 768\n2024 789\n2025 920\n2026 98\nPublication date\n1 year\n5 years\n10 years\nCustom Range\nStart Date\nEnd Date\nClear\nApply\nText availability\nAbstract\nFree full text\nFull text\nArticle attribute\nAssociated data\nArticle type\nBooks and Documents\nClinical Trial\nMeta-Analysis\nRandomized Controlled Trial\nReview\nSystematic Review\nSee all article type filters\nAdditional filters\nAdditional filters\nArticle Language\nEnglish\nSpanish\nSee all article language filters\nSpecies\nHumans\nOther Animals\nSex\nFemale\nMale\nAge\nChild: birth-18 years\nAdult: 19+ years\nAged: 65+ years\nSee all age filters\nOther\nExclude preprints\nMEDLINE\nClear applied filters\nReset filters menu\nSearch Results\nclear all\n13,070 results\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nClear selection\nPage\nof 1,307\nResults by year\nExpand/collapse timeline\nReset\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nClear selection\nFilters applied: . Clear all\nSelect search result to email or save\nPage 1\n1\nCite\nBetter together-Salmonella biofilm-associated antibiotic resistance.\nAleksandrowicz A, Carolak E, Dutkiewicz A, B\u0142achut A, Waszczuk W, Grzymajlo K. Aleksandrowicz A, et al. Gut Microbes. 2023 Jan-Dec;15(1):2229937. doi: 10.1080/19490976.2023.2229937. Gut Microbes. 2023. PMID: 37401756 Free PMC article. Review.\nSalmonella poses a serious threat to public health and socioeconomic development worldwide because of its foodborne pathogenicity and antimicrobial resistance. This biofilm-planktonic lifestyle enables Salmonella to interfere with the host and become resis \u2026\nSalmonella poses a serious threat to public health and socioeconomic development worldwide because of its foodborne pathogenicity and \u2026\nCite\nItem in Clipboard\n2\nCite\nAntibiotic-resistant Salmonella in swine wastes and farm surface waters.\nCasanova LM, Hill VR, Sobsey MD. Casanova LM, et al. Lett Appl Microbiol. 2020 Jul;71(1):117-123. doi: 10.1111/lam.13242. Epub 2020 Jan 16. Lett Appl Microbiol. 2020. PMID: 31648373\nThe objective of this research was to determine whether Salmonella resistant to clinically relevant antibiotics were present in wastewaters and surface waters from hog CAFOs. ...No resistance to cephalosporin or fluoroquinolones was found. Resistanc \u2026\nThe objective of this research was to determine whether Salmonella resistant to clinically relevant antibiotics were pr \u2026\nCite\nItem in Clipboard\n3\nCite\nSalmonella infection - prevention and treatment by antibiotics and probiotic yeasts: a review.\nGut AM, Vasiljevic T, Yeager T, Donkor ON. Gut AM, et al. Microbiology (Reading). 2018 Nov;164(11):1327-1344. doi: 10.1099/mic.0.000709. Epub 2018 Aug 23. Microbiology (Reading). 2018. PMID: 30136920 Free article. Review.\nThe use of antibiotic drugs in treating the infection is proving less effective due to the alarming rise of antibiotic-resistant strains of Salmonella, the effects of antibiotics on normal gut microflora and antibiotic-associated diarrhoe \u2026\nThe use of antibiotic drugs in treating the infection is proving less effective due to the alarming rise of antibiotic-resi \u2026\nCite\nItem in Clipboard\n4\nCite\nFructose-enabled killing of antibiotic-resistant Salmonella enteritidis by gentamicin: Insight from reprogramming metabolomics.\nJiang M, Li X, Xie CL, Chen P, Luo W, Lin CX, Wang Q, Shu DM, Luo CL, Qu H, Ji J. Jiang M, et al. Int J Antimicrob Agents. 2023 Sep;62(3):106907. doi: 10.1016/j.ijantimicag.2023.106907. Epub 2023 Jun 28. Int J Antimicrob Agents. 2023. PMID: 37385564 Free article.\nAntibiotics are critical for the initial treatment of bacterial infections. However, the overuse and misuse of antibiotics results in the rapid evolution of antibiotic-resistant bacteria, and the discovery and development of new antibiotics are \u2026\nAntibiotics are critical for the initial treatment of bacterial infections. However, the overuse and misuse of antibiotics res \u2026\nCite\nItem in Clipboard\n5\nCite\nVariability in the Adaptive Response of Antibiotic-Resistant Sa", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/4d1e1378-2480-4c0c-9537-78a856dba1f8", "content_hash": "66e99592c676428816d2aff4b3b1f579538c003c0f26121a8c3d3b694f8e97a4", "created_at": "2026-03-28T05:13:06.875807712Z"}
{"id": "47ca4a33-464e-41a8-9c2c-93689c24e9d0", "source": "brain", "text": "Effects of red-cell storage duration on patients undergoing cardiac surgery\n\nEffects of red-cell storage duration on patients undergoing cardiac surgery\nEffects of red-cell storage duration on patients undergoing cardiac surgery\nN Engl J Med. 2015 Apr 9;372(15):1419-29. doi: 10.1056/NEJMoa1414219.\nAuthors\nMarie E Steiner 1 , Paul M Ness, Susan F Assmann, Darrell J Triulzi, Steven R Sloan, Meghan Delaney, Suzanne Granger, Elliott Bennett-Guerrero, Morris A Blajchman, Vincent Scavo, Jeffrey L Carson, Jerrold H Levy, Glenn Whitman, Pamela D'Andrea, Shelley Pulkrabek, Thomas L Ortel, Larissa Bornikova, Thomas Raife, Kathleen E Puca, Richard M Kaufman, Gregory A Nuttall, Pampee P Young, Samuel Youssef, Richard Engelman, Philip E Greilich, Ronald Miles, Cassandra D Josephson, Arthur Bracey, Rhonda Cooke, Jeffrey McCullough, Robert Hunsaker, Lynne Uhl, Janice G McFarland, Yara Park, Melissa M Cushing, Charles T Klodell, Ravindra Karanam, Pamela R Roberts, Cornelius Dyke, Eldad A Hod, Christopher P Stowell\nAffiliation\n1 From Fairview-University Medical Center, Minneapolis (M.E.S., S.P., J.M.), and Mayo Clinic, Rochester (G.A.N.) - both in Minnesota; Johns Hopkins University (P.M.N., G.W.) and University of Maryland (R.C.) - both in Baltimore; New England Research Institutes, Data Coordinating Center, Watertown (S.F.A., S.G.), Boston Children's Hospital (S.R.S.), Massachusetts General Hospital (L.B., C.P.S.), Brigham and Women's Hospital (R.M.K.), Tufts University (R.E.), St. Elizabeth's Medical Center (R.H.), and Beth Israel Deaconess Medical Center (L.U.), Boston, and Baystate Medical Center, Springfield (R.E.) - all in Massachusetts; University of Pittsburgh and University of Pittsburgh-Mercy Hospital, Pittsburgh (D.J.T., P.D.); Puget Sound Blood Center and University of Washington (M.D.) and Swedish Medical Center (S.Y.) - all in Seattle; Duke University, Durham (E.B.-G., J.H.L., T.L.O.), and University of North Carolina, Chapel Hill (Y.P.) - both in North Carolina; McMaster University, Hamilton, ON, Canada (M.A.B.); Indiana-Ohio Heart and St. Joseph Hospital (V.S.) - both in Fort Wayne, IN; Rutgers Robert Wood Johnson Medical School, New Brunswick (J.L.C.), and Newark Beth Israel Medical Center, Newark (R.K.) - both in New Jersey; University of Iowa, Iowa City (T.R.); Aurora St. Luke's Medical Center (K.E.P.) and Froedert Memorial Lutheran Hospital (J.G.M.), Milwaukee, and Aspirus Heart and Vascular Institute, Wausau (R.M.) - all in Wisconsin; Vanderbilt University, Nashville (P.P.Y.); University of Texas Southwestern Medical Center, Dallas (P.E.G.); Children's Healthcare of Atlanta, Emory University, and Emory University Hospital, Atlanta (C.D.J.); St. Luke's-Texas Heart Institute, Houston (A.B.); Weill Cornell Medical College (M.M.C.) and Columbia University Medical Center (E.A.H.) - both in New York; University of Florida, Gainesville (C.T.K.); University of Oklahoma, Oklahoma City (P.R.R.); and University of North Dakota School of Medicine and Health Sciences, Fargo (C.D.).\nPMID: 25853746\nPMCID: PMC5442442\nDOI: 10.1056/NEJMoa1414219\nAbstract\nBackground: Some observational studies have reported that transfusion of red-cell units that have been stored for more than 2 to 3 weeks is associated with serious, even fatal, adverse events. Patients undergoing cardiac surgery may be especially vulnerable to the adverse effects of transfusion.\nMethods: We conducted a randomized trial at multiple sites from 2010 to 2014. Participants 12 years of age or older who were undergoing complex cardiac surgery and were likely to undergo transfusion of red cells were randomly assigned to receive leukocyte-reduced red cells stored for 10 days or less (shorter-term storage group) or for 21 days or more (longer-term storage group) for all intraoperative and postoperative transfusions. The primary outcome was the change in Multiple Organ Dysfunction Score (MODS; range, 0 to 24, with higher scores indicating more severe organ dysfunction) from the preoperative score to the highest composite score through day 7 or the time of death or discharge.\nResults: The median storage time of red-cell units provided to the 1098 participants who received red-cell transfusion was 7 days in the shorter-term storage group and 28 days in the longer-term storage group. The mean change in MODS was an increase of 8.5 and 8.7 points, respectively (95% confidence interval for the difference, -0.6 to 0.3; P=0.44). The 7-day mortality was 2.8% in the shorter-term storage group and 2.0% in the longer-term storage group (P=0.43); 28-day mortality was 4.4% and 5.3%, respectively (P=0.57). Adverse events did not differ significantly between groups except that hyperbilirubinemia was more common in the longer-term storage group.\nConclusions: The duration of red-cell storage was not associated with significant differences in the change in MODS. We did not find that the transfusion of red cells stored for 10 days or less was superior to the transfusion of red cells stored for 21 days or more among patients 12 years of age or older who were undergoing complex cardiac surgery. (Funded by the National Heart, Lung, and Blood Institute; RECESS ClinicalTrials.gov number, NCT00991341.).\nPublication types\nComparative Study\nMulticenter Study\nRandomized Controlled Trial\nResearch Support, N.I.H., Extramural\nMeSH terms\nAdult\nAged\nBlood Grouping and Crossmatching\nBlood Preservation*\nCardiac Surgical Procedures*\nErythrocyte Transfusion* / adverse effects\nFemale\nHumans\nIntention to Treat Analysis\nLength of Stay\nMale\nMiddle Aged\nMortality\nMultiple Organ Failure / classification\nProportional Hazards Models\nSeverity of Illness Index\nTime Factors\nAssociated data\nClinicalTrials.gov/NCT00991341\nGrants and funding\nR01 HL101382/HL/NHLBI NIH HHS/United States\nU01 HL072331/HL/NHLBI NIH HHS/United States\nUL1 RR025758/RR/NCRR NIH HHS/United States", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/47ca4a33-464e-41a8-9c2c-93689c24e9d0", "content_hash": "c80fbaff8fbb4e0606d8796fcff91e70fcd2cec47785df482f4c29e24f98ee2b", "created_at": "2026-03-28T05:13:06.746474357Z"}
{"id": "0a58f86e-6eaa-41fb-9665-72d26064d8cf", "source": "brain", "text": "Pregnenolone and dehydroepiandrosterone as an adjunctive treatment in schizophrenia and schizoaffective disorder: an 8-week, double-blind, randomiz...\n\nPregnenolone and dehydroepiandrosterone as an adjunctive treatment in schizophrenia and schizoaffective disorder: an 8-week, double-blind, randomized, controlled, 2-center, parallel-group trial\nPregnenolone and dehydroepiandrosterone as an adjunctive treatment in schizophrenia and schizoaffective disorder: an 8-week, double-blind, randomized, controlled, 2-center, parallel-group trial\nJ Clin Psychiatry. 2010 Oct;71(10):1351-62. doi: 10.4088/JCP.09m05031yel. Epub 2010 Jun 15.\nAuthors\nMichael S Ritsner 1 , Anatoly Gibel, Tatyana Shleifer, Igor Boguslavsky, Ahmad Zayed, Rachel Maayan, Abraham Weizman, Vladimir Lerner\nAffiliation\n1 Department of Psychiatry, The Rappaport Faculty of Medicine, Technion\u2013Israel Institute of Technology, Haifa, Israel. <EMAIL_17>\nPMID: 20584515\nDOI: 10.4088/JCP.09m05031yel\nAbstract\nObjective: Pregnenolone (PREG) and dehydroepiandrosterone (DHEA) are reported to have a modulatory effect on neuronal excitability, synaptic plasticity, and response to stress; they are associated with mood regulation and cognitive performance. We investigated the influence of PREG and DHEA on psychotic symptoms and cognitive functioning as an add-on to ongoing antipsychotic treatment of patients with chronic schizophrenia or schizoaffective disorder.\nMethod: This 8-week, double-blind, randomized, placebo-controlled, 2-center study compared 30 mg/d of PREG (PREG-30), 200 mg/d of PREG (PREG-200), 400 mg/d of DHEA, and placebo as an adjunctive treatment of 58 chronic schizophrenia or schizoaffective disorder patients (DSM-IV). The data were collected from February 2005 until June 2007. The outcome measures were symptomatic and neurocognitive changes, functioning, and tolerability as assessed primarily by the Clinical Global Impressions-Severity of Illness scale and the Positive and Negative Syndrome Scale. Analyses are presented for 44 patients who completed 8 weeks of treatment and for 14 noncompleters.\nResults: Compared with subjects who received placebo, those administered PREG-30 had significant reductions in positive symptom scores and extrapyramidal side effects (EPS) and improvement in attention and working memory performance, whereas subjects treated with PREG-200 did not differ on outcome variable scores for the study period. The general psychopathology severity and general functioning of patients receiving placebo and PREG-30 improved more than that of those subjects treated with DHEA, while EPS improved more in subjects treated with DHEA than in patients receiving placebo. Negative symptoms and akathisia were not significantly benefited by any treatment. The administration of PREG and DHEA was well tolerated.\nConclusions: Low-dose PREG augmentation demonstrated significant amelioration of positive symptoms and EPS and improvement in attention and working memory performance of schizophrenia and schizoaffective disorder patients. Further double-blind controlled studies are needed to investigate the clinical benefit of pregnenolone augmentation.\nTrial registration: clinicaltrials.gov Identifier: NCT00174889.\n\u00a9 Copyright 2010 Physicians Postgraduate Press, Inc.\nPublication types\nMulticenter Study\nRandomized Controlled Trial\nMeSH terms\nAdolescent\nAdult\nAntipsychotic Agents / administration & dosage\nAttention / drug effects\nDehydroepiandrosterone / administration & dosage*\nDehydroepiandrosterone / adverse effects\nDose-Response Relationship, Drug\nDouble-Blind Method\nDrug Therapy, Combination* / adverse effects\nDyskinesia, Drug-Induced / drug therapy\nFemale\nHumans\nMale\nMemory, Short-Term / drug effects\nMiddle Aged\nNeurotransmitter Agents / administration & dosage*\nNeurotransmitter Agents / adverse effects\nPregnenolone / administration & dosage*\nPregnenolone / adverse effects\nPsychotic Disorders / drug therapy*\nSchizophrenia / drug therapy*\nSeverity of Illness Index\nSubstances\nAntipsychotic Agents\nNeurotransmitter Agents\nDehydroepiandrosterone\nPregnenolone\nAssociated data\nClinicalTrials.gov/NCT00174889", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/0a58f86e-6eaa-41fb-9665-72d26064d8cf", "content_hash": "36297aaab1cc479394a22241d10af5d67c8c80e43cba7bc5a1f769ce278685e3", "created_at": "2026-03-28T05:13:06.395034927Z"}
{"id": "3f1fb337-0754-49df-9e21-a39dbed66588", "source": "brain", "text": "Vantilat\u00f6rler Fiyatlar\u0131 & Modelleri - Pasaj\n\nVantilat\u00f6rler Fiyatlar\u0131 & Modelleri - Pasaj\nturkcell.com.tr\nKampanyalar Markalar Favorilerim Sipari\u015f Sorgulama Yard\u0131m Pasaj Blog\nGiri\u015f Yap Hesab\u0131m\nPasaj Limitini \u00d6\u011fren\nSipari\u015flerim\nFavorilerim\nHediye \u00c7eklerim\nDe\u011ferlendirmelerim\n\u00dcr\u00fcn Sorular\u0131m\nKullan\u0131c\u0131 Bilgilerim\nKay\u0131tl\u0131 Kartlar\u0131m\nAdreslerim\nYard\u0131m Merkezi\n\u00c7\u0131k\u0131\u015f Yap\nSepetim 0\nCep Telefonu-Aksesuar Bilgisayar-Tablet Elektrikli Ev Aletleri Sa\u011fl\u0131k-Ki\u015fisel Bak\u0131m Hobi-Oyun TV-Ses Sistemleri Ev-Ya\u015fam\nCep Telefonu-Aksesuar\nApple Telefonlar\niPhone 17\niPhone 16\niPhone 15\niPhone 14\niPhone 13\niPhone 12\niPhone 11\niPhone SE\nAndroid Telefonlar\nYapay Zeka (AI) Telefonlar\nGiyilebilir Teknolojiler\nAk\u0131ll\u0131 Saatler\nAk\u0131ll\u0131 Bileklikler\nAk\u0131ll\u0131 \u00c7ocuk Saatleri\nTakip Cihazlar\u0131\nAksesuarlar\nTelefon K\u0131l\u0131flar\u0131\nAirPods\nKulakl\u0131klar\nKablo D\u00fczenleyiciler\nAk\u0131ll\u0131 Saat Aksesuarlar\u0131\nAirPods Aksesuarlar\u0131\nEkran Koruyucular\n\u015earj Cihazlar\u0131\nTelefon Ask\u0131s\u0131\nTelefon Tutucular\nD\u00f6n\u00fc\u015ft\u00fcr\u00fcc\u00fcler\nTu\u015flu Telefonlar\nYenilenmi\u015f Telefonlar\n5G Destekli Ak\u0131ll\u0131 Telefonlar\nT\u00fcm Cep Telefonu-Aksesuar\nBilgisayar-Tablet\nMasa\u00fcst\u00fc Bilgisayarlar\nMac mini\niMac\nAll-in-One Bilgisayarlar\nMasa\u00fcst\u00fc Bilgisayarlar\nKasalar\nDiz\u00fcst\u00fc Bilgisayarlar\nMacBook\nLaptoplar\nOyun Bilgisayarlar\u0131\nTabletler\nApple Tabletler\nAndroid Tabletler\nMacBook Aksesuarlar\u0131\nMacBook \u015earj Cihazlar\u0131\nMacBook \u00c7anta ve K\u0131l\u0131flar\u0131\nModem & Network \u00dcr\u00fcnleri\nModemler\nNetwork \u00dcr\u00fcnleri\nVeri Depolama \u00dcr\u00fcnleri\nHarici Diskler\nUSB Bellekler\nHaf\u0131za Kartlar\u0131\nSSD - Hard Diskleri\nBilgisayar \u00c7evre Birimleri\nMonit\u00f6rler\nKlavyeler\nBiIgisayar Kulakl\u0131klar\u0131\nHoparl\u00f6rler\nMouselar\nMouse Padleri\nD\u00f6n\u00fc\u015ft\u00fcr\u00fcc\u00fcler\nSo\u011futucu & Y\u00fckselticiler\nWebcam \u00dcr\u00fcnleri\nKablolar\nLaptop \u00c7antalar\u0131\nUPS & G\u00fc\u00e7 Kaynaklar\u0131\n3D Yaz\u0131c\u0131lar\nYaz\u0131c\u0131lar\nYaz\u0131c\u0131 Sarf \u00dcr\u00fcnleri\nTablet Aksesuarlar\u0131\nTablet K\u0131l\u0131flar\u0131\nTablet Ekran Koruyucular\nTablet Tutucular\nTablet Klavyeleri\nTablet Kalemleri\nT\u00fcm Bilgisayar-Tablet\nElektrikli Ev Aletleri\n\u00dct\u00fcler\nBuharl\u0131 \u00dct\u00fcler\nBuhar Kazanl\u0131 \u00dct\u00fcler\n\u00dct\u00fc Masalar\u0131\nS\u00fcp\u00fcrgeler\nRobot S\u00fcp\u00fcrgeler\n\u015earjl\u0131 S\u00fcp\u00fcrgeler\nDikey S\u00fcp\u00fcrgeler\nToz Torbas\u0131z S\u00fcp\u00fcrgeler\nToz Torbal\u0131 S\u00fcp\u00fcrgeler\nElektrikli Mutfak Aletleri\nAirfryer & Frit\u00f6zler\nMutfak Robotlar\u0131\nBlender & Mikserler\nKahve Makineleri\nKahve \u00c7e\u015fitleri\n\u00c7ay Makineleri\nTost Makineleri\nEkmek Yapma Makineleri\nEkmek K\u0131zartma Makineleri\nMeyve S\u0131kacaklar\u0131\nPi\u015firiciler\nSu Is\u0131t\u0131c\u0131lar\u0131\nSu Sebilleri\nSu Ar\u0131tma Cihazlar\u0131\nTeknolojik Mutfak Aletleri\nMutfak Gere\u00e7leri\nTava & Tencere & D\u00fcd\u00fckl\u00fc Tencere\nYemek & Kahvalt\u0131 Tak\u0131mlar\u0131\n\u00c7atal & Ka\u015f\u0131k & B\u0131\u00e7ak Tak\u0131mlar\u0131\nYemek Haz\u0131rl\u0131k Gere\u00e7leri\nSaklama & D\u00fczenleme Kaplar\u0131\n\u00c7aydanl\u0131k\nYap\u0131 Aletleri\nHava Temizleme Cihazlar\u0131\nDiki\u015f Makineleri\nF\u0131r\u0131nlar\nMikrodalga F\u0131r\u0131nlar\nMini F\u0131r\u0131nlar\nIs\u0131tma ve So\u011futma Sistemleri\nVantilat\u00f6rler\nRadyat\u00f6rler\nT\u00fcm Elektrikli Ev Aletleri\nSa\u011fl\u0131k-Ki\u015fisel Bak\u0131m\nCilt Bak\u0131m Teknolojileri\nSa\u00e7 Bak\u0131m \u00dcr\u00fcnleri\nSa\u00e7 Kurutma Makineleri\nSa\u00e7 \u015eekillendiriciler\nSa\u00e7 D\u00fczle\u015ftiricileri\nErkek Bak\u0131m \u00dcr\u00fcnleri\nT\u0131ra\u015f Makineleri\nSa\u00e7 & Sakal Kesme Makineleri\nA\u011f\u0131z Bak\u0131m \u00dcr\u00fcnleri\n\u015earjl\u0131 Di\u015f F\u0131r\u00e7alar\u0131\nA\u011f\u0131z Du\u015flar\u0131\nEpilat\u00f6rler & IPL Cihazlar\u0131\nEpilat\u00f6rler\nLazer Epilasyon & IPL Cihazlar\u0131\nAte\u015f \u00d6l\u00e7erler & Tansiyon Aletleri\nAte\u015f \u00d6l\u00e7erler\nTansiyon Aletleri\nMasaj Aletleri\nTart\u0131lar\nT\u00fcm Sa\u011fl\u0131k-Ki\u015fisel Bak\u0131m\nHobi-Oyun\nOyun Konsollar\u0131\nPlaystation 5 / PS5\nPlaystation 4 / PS4\nNintendo\nxbox\nDi\u011fer Oyun Konsollar\u0131\nDijital \u00dcr\u00fcn Kodlar\u0131\nDestek Kartlar\u0131\nOyun Pinleri - \u00dcyelikler\nSpor - Dizi - Film Yay\u0131n Paketleri\nOnline E\u011fitim\nE\u011flence ve M\u00fczik\nSaklama Alan\u0131\nDijital Sigorta \u00dcr\u00fcnleri\nOyuncu Aksesuarlar\u0131\nOyuncu Klavyeleri\nOyuncu Mouselar\u0131\nOyuncu Kulakl\u0131klar\u0131\nOyuncu Koltuklar\u0131\nOyuncu Joystickleri\nKonsol Aksesuarlar\u0131\nMobil Oyun Aksesuarlar\u0131\nOyunlar\nPlaystation & Konsol Oyunlar\u0131\nFoto\u011fraf & Kameralar\nFoto\u011fraf Makineleri\nAksiyon Kameralar\u0131\nPolaroid Foto\u011fraf Makineleri\nFoto\u011fraf Yaz\u0131c\u0131lar\u0131\nYoutuber & Yay\u0131nc\u0131 \u00dcr\u00fcnleri\nMikrofonlar\nDronelar\nScooterlar ve Bisikletler\nYeti\u015fkin Hobi & E\u011flence\nM\u00fczik \u00dcr\u00fcnleri\nPlaklar\nPikaplar\n\u00d6deme Kartlar\u0131\nT\u00fcm Hobi-Oyun\nTV-Ses Sistemleri\nTelevizyonlar\nSmart TV\nLED TV\n4K TV\n8K TV\nOLED TV\nQLED TV\nProjeksiyon Sistemleri\nProjeksiyon Cihazlar\u0131\nTa\u015f\u0131nabilir Projeksiyon Cihazlar\u0131\nSes Sistemleri\nBluetooth Hoparl\u00f6rler\nEv Sinema Sistemleri\nSoundbar\nMedia Player\nT\u00fcm TV-Ses Sistemleri\nEv-Ya\u015fam\nSpor \u00dcr\u00fcnleri\nFitness \u00dcr\u00fcnleri\nTermos\nKamp Malzemeleri & Outdoor \u00dcr\u00fcnleri\nYoga-Pilates \u00dcr\u00fcnleri\nBebek & \u00c7ocuk\nBebek Bak\u0131m\nMama Haz\u0131rlay\u0131c\u0131lar\nOyuncaklar\nG\u00fcvenlik \u00dcr\u00fcnleri\nAk\u0131ll\u0131 Ev \u00c7\u00f6z\u00fcmleri\nAyd\u0131nlatma \u00dcr\u00fcnleri\nG\u00fcvenlik \u00c7\u00f6z\u00fcmleri\nPet Shop\nAk\u0131ll\u0131 Mama / Su Kaplar\u0131\nAk\u0131ll\u0131 Tuvaletler\nTeknolojik \u00dcr\u00fcnler\n\u00c7anta & Valiz\nValizler\n\u015eemsiyeler\nAra\u00e7 \u00c7\u00f6z\u00fcmleri\nAra\u00e7 G\u00fcvenlik Teknolojileri\nAra\u00e7 Donan\u0131m \u00dcr\u00fcnleri\nServiscell\nYap\u0131 Market \u00dcr\u00fcnleri\nAk\u0131m Korumal\u0131 Prizler\nOfis Malzemeleri\nEvrak \u0130mha Makineleri\nPiller\nOfis Mobilyalar\u0131\nMasa\u00fcst\u00fc Gere\u00e7leri\nAk\u0131ll\u0131 & \u0130lgin\u00e7 \u00dcr\u00fcnler\nT\u00fcm Ev-Ya\u015fam\nGiri\u015f\nSize \u00f6zel \u00f6deme avantajlar\u0131 ve size \u00f6zel tekliflerden faydalanmak i\u00e7in Giri\u015f Yap/\u00dcye Ol se\u00e7ene\u011fi ile devam edebilirsiniz.\nH\u0131zl\u0131 Giri\u015f\nGiri\u015f Yapmadan Devam Et\nKurumsal Yetkili Giri\u015fi\nPasaj\nElektrikli Ev Aletleri\nIs\u0131tma ve So\u011futma Sistemleri\nVantilat\u00f6rler\nVantilat\u00f6rler\nFiltreleri Temizle\nKar\u015f\u0131la\u015ft\u0131rma Modu\nKar\u015f\u0131la\u015ft\u0131rma i\u00e7in en az iki cihaz se\u00e7melisiniz.\nTemizle\nKar\u015f\u0131la\u015ft\u0131r\nArama kriterlerinize uygun cihaz bulunamad\u0131.\nBizi Takip Edin\nSosyal medya hesaplar\u0131m\u0131zdan bizi takip edin, f\u0131rsatlar\u0131 ka\u00e7\u0131rmay\u0131n.\nTurkcell Uygulamas\u0131n\u0131 \u0130ndir\nQR kodunu taratarak uygulamay\u0131 hemen indirebilirsiniz. Pasaj ile ilgili t\u00fcm i\u015flemlerinizi Turkcell Uygulamas\u0131ndan h\u0131zl\u0131ca ger\u00e7ekle\u015ftirebilirsiniz.\nHakk\u0131m\u0131zda\nPasaj Genel Bak\u0131\u015f\nHaberler & Duyurular\nKurumsal \u0130leti\u015fim ve S\u00fcrd\u00fcr\u00fcrebilirlik\nKariyer\nGizlilik ve G\u00fcvenlik\nPasaj \u0130leti\u015fim\nPasaj Blog\nPasaj Gaming\nTurkcell Blog\nAk\u0131ll\u0131 Ev\n5G\nT\u00fcm\u00fcn\u00fc G\u00f6r\nPop\u00fcler Kategoriler\nCep Telefonu\nAndroid Telefonlar\niPhone Modelleri\n\u0130kinci El / Yenilenmi\u015f Telefonlar\nYenilenmi\u015f iPhone\n5G Uyumlu Telefonlar\nAk\u0131ll\u0131 Saatler\nBluetooth Kulakl\u0131klar\nTabletler\nLaptop\nOyun Bilgisayarlar\u0131\nDikey S\u00fcp\u00fcrgeler\nRobot S\u00fcp\u00fcrgeler\nKahve Makineleri\nTelevizyon\nAirfryer\nKulakl\u0131klar\n\u00c7ocuk Ak\u0131ll\u0131 Saat\nKulaki\u00e7i Kulakl\u0131k\nKettle\nSa\u00e7 D\u00fczle\u015ftirici\nAirpods\nT\u00fcm\u00fcn\u00fc G\u00f6r\nYard\u0131m\nYard\u0131m Merkezi\n\u0130\u015flem Rehberi\n\u00dcr\u00fcn G\u00fcvenli\u011fi Temas Noktas\u0131\nNas\u0131l \u0130ade Edebilirim?\nPasaj Sipari\u015f Sorgulama\niPhone Kar\u015f\u0131la\u015ft\u0131rma\nTelevizyon (TV) Kar\u015f\u0131la\u015ft\u0131rma\nTelefon Sat\nPop\u00fcler Marka Kategoriler\nSamsung Telefonlar\nJBL Kulakl\u0131k\nPhilips Kahve Makinesi\nSamsung Tablet\nDyson Sa\u00e7 D\u00fczle\u015ftirici\nPhilips Dikey S\u00fcp\u00fcrge\nPhilips S\u00fcp\u00fcrge\nKaraca Kahve Makinesi\nPhilips Airfryer\nApple Kulakl\u0131k\nDyson Hava Temizleyici\nHuawei Ak\u0131ll\u0131 Saat\nPhilips \u00dct\u00fc\nJBL Hoparl\u00f6r\nApple Tablet\nXiaomi Telefon\nXiaomi Ak\u0131ll\u0131 Saat\nSamsung Ak\u0131ll\u0131 Saat\nAsus Laptop\nHuawei Tablet\nDyson Robot S\u00fcp\u00fcrge\nHuawei Telefon\nStanley Termos\nT\u00fcm\u00fcn\u00fc G\u00f6r\nMarkalar\nApple\nSamsung\nDyson\nAnker\nArzum\nBeko\nBosch\nBraun\nCasper\nDelonghi\nHuawei\nJBL\nKaraca\nKarcher\nLego\nLenovo\nOmix\nPhilips\nRealme\nXiaomi\nVestel\nTCL\nSony\nSiemens\nT\u00fcm\u00fcn\u00fc G\u00f6r\n\u00d6zel G\u00fcnler & Kampanyalar\nRamazan Tarifleri & Ramazan Kampanyalar\u0131\nD\u00fc\u011f\u00fcn ve \u00c7eyiz Paketleri\nF\u0131rsatlar Pasaj\u0131\nPasaj G\u00fcnleri\nUykusu Ka\u00e7anlar Kul\u00fcb\u00fc\nSevgililer G\u00fcn\u00fc Hediyeleri\nVergisiz Telefonlar\nVergisiz Bilgisayarlar\nKarne Hediyeleri\nKurban Bayram\u0131 Kampanyas\u0131\nResmi Tatil G\u00fcnleri\nPasaj \u00d6deme Teklifleri\nAnneler G\u00fcn\u00fc Hediyeleri\nBabalar G\u00fcn\u00fc\nTaksitli Harikalar Diyar\u0131\nOkula D\u00f6n\u00fc\u015f Kampanyas\u0131\nT\u00fcm\u00fcn\u00fc G\u00f6r\nPop\u00fcler \u00dcr\u00fcnler\niPhone 17\niPhone 16\niPhone Air\niPhone 16 Pro Max\niPhone 17 Pro Max\niPhone 16E\niPhone 15\niPhone 15 Plus\niPhone 15 Pro\niPhone 15 Pro Max\niPhone 14\niPhone 14 Plus\niPhone 14 Pro\niPhone 14 Pro Max\niPhone 13\niPhone 12\niPhone 11\niPhone SE\nDyson Airwrap\nDyson V15\nDyson V15 Detect Submarine\nDyson Airstrait\nDyson V12\nDyson V8\nSamsung Galaxy S25\nSamsung Galaxy S25 Ultra\nPS5 / Playstation 5\nPS4 / Playstation 4\nNintendo Switch\nXbox Series S\nXbox Series X\nT\u00fcm\u00fcn\u00fc G\u00f6r\nT\u00fcrk\u00e7e\nEnglish\n\u0639\u0631\u0628\u0649\n\u0440\u0443\u0441\u0441\u043a\u0438\u0439\nGizlilik ve G\u00fcvenlik\n\u00a9 2025 Turkcell\nHatal\u0131 Giri\u015f\npassage.modal.login.error.text\nKapat\n\u00c7\u0131k\u0131\u015f yapmak istedi\u011finize emin misiniz?\nVazge\u00e7 \u00c7\u0131k\u0131s Yap\npassage.modal.login.timeout.info.title\npassage.modal.login.timeout.info.desc\npassage.modal.login.timeout.logout passage.modal.login.timeout.continue", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/3f1fb337-0754-49df-9e21-a39dbed66588", "content_hash": "8596f81c33c6b702124ec8d78fb5a59e733565204dd0e4294eab59d0d2e04ace", "created_at": "2026-03-28T05:11:12.245680370Z"}
{"id": "eaf18c08-52e5-47f5-99e5-4e9316bfe774", "source": "brain", "text": "tf.extract_volume_patches | TensorFlow v2.4.0\n\ntf.extract_volume_patches | TensorFlow v2.4.0\nSkip to main content\nInstall Learn\nIntroduction\nNew to TensorFlow?\nTutorials\nLearn how to use TensorFlow with end-to-end examples\nGuide\nLearn framework concepts and components\nLearn ML\nEducational resources to master your path with TensorFlow\nAPI\nTensorFlow (v2.16.1)\nVersions\u2026\nTensorFlow.js\nTensorFlow Lite\nTFX\nEcosystem\nLIBRARIES\nTensorFlow.js\nDevelop web ML applications in JavaScript\nTensorFlow Lite\nDeploy ML on mobile, microcontrollers and other edge devices\nTFX\nBuild production ML pipelines\nAll libraries\nCreate advanced models and extend TensorFlow\nRESOURCES\nModels & datasets\nPre-trained models and datasets built by Google and the community\nTools\nTools to support and accelerate TensorFlow workflows\nResponsible AI\nResources for every stage of the ML workflow\nRecommendation systems\nBuild recommendation systems with open source tools\nCommunity\nGroups\nUser groups, interest groups and mailing lists\nContribute\nGuide for contributing to code and documentation\nBlog\nStay up to date with all things TensorFlow\nForum\nDiscussion platform for the TensorFlow community\nWhy TensorFlow\nAbout\nCase studies\n/\nEnglish\n\u4e2d\u6587 \u2013 \u7b80\u4f53\nGitHub Sign in\nTensorFlow v2.4.0\nOverview Python C++ Java\nInstall\nLearn\nMore\nAPI\nMore\nOverview\nPython\nC++\nJava\nEcosystem\nMore\nCommunity\nMore\nWhy TensorFlow\nMore\nGitHub\nOverview\nAll Symbols\nPython v2.4.0\ntf\nOverview\nAggregationMethod\nCriticalSection\nDeviceSpec\nGradientTape\nGraph\nIndexedSlices\nIndexedSlicesSpec\nModule\nOperation\nOptionalSpec\nRaggedTensor\nRaggedTensorSpec\nRegisterGradient\nSparseTensorSpec\nTensor\nTensorArray\nTensorArraySpec\nTensorShape\nTensorSpec\nTypeSpec\nUnconnectedGradients\nVariable\nVariable.SaveSliceInfo\nVariableAggregation\nVariableSynchronization\nargsort\nbatch_to_space\nbitcast\nboolean_mask\nbroadcast_dynamic_shape\nbroadcast_static_shape\nbroadcast_to\ncase\ncast\nclip_by_global_norm\nclip_by_norm\nclip_by_value\nconcat\ncond\nconstant\nconstant_initializer\ncontrol_dependencies\nconvert_to_tensor\ncustom_gradient\ndevice\ndynamic_partition\ndynamic_stitch\nedit_distance\neinsum\nensure_shape\nexecuting_eagerly\nexpand_dims\nextract_volume_patches\neye\nfill\nfingerprint\nfoldl\nfoldr\nfunction\ngather\ngather_nd\nget_logger\nget_static_value\ngrad_pass_through\ngradients\ngroup\nguarantee_const\nhessians\nhistogram_fixed_width\nhistogram_fixed_width_bins\nidentity\nidentity_n\ninit_scope\ninside_function\nis_tensor\nlinspace\nload_library\nload_op_library\nmake_ndarray\nmake_tensor_proto\nmap_fn\nmeshgrid\nname_scope\nno_gradient\nno_op\nnondifferentiable_batch_function\nnorm\nnumpy_function\none_hot\nones\nones_initializer\nones_like\npad\nparallel_stack\nprint\npy_function\nquantize_and_dequantize_v4\nrandom_normal_initializer\nrandom_uniform_initializer\nrange\nrank\nrealdiv\nrecompute_grad\nregister_tensor_conversion_function\nrepeat\nrequired_space_to_batch_paddings\nreshape\nreverse\nreverse_sequence\nroll\nscan\nscatter_nd\nsearchsorted\nsequence_mask\nshape\nshape_n\nsize\nslice\nsort\nspace_to_batch\nspace_to_batch_nd\nsplit\nsqueeze\nstack\nstop_gradient\nstrided_slice\nswitch_case\ntensor_scatter_nd_add\ntensor_scatter_nd_max\ntensor_scatter_nd_min\ntensor_scatter_nd_sub\ntensor_scatter_nd_update\ntensordot\ntile\ntimestamp\ntranspose\ntruncatediv\ntruncatemod\ntuple\ntype_spec_from_value\nunique\nunique_with_counts\nunravel_index\nunstack\nvariable_creator_scope\nvectorized_map\nwhere\nwhile_loop\nzeros\nzeros_initializer\nzeros_like\ntf.audio\nOverview\ndecode_wav\nencode_wav\ntf.autodiff\nOverview\nForwardAccumulator\ntf.autograph\nOverview\nset_verbosity\nto_code\nto_graph\ntrace\nexperimental\nOverview\nFeature\ndo_not_convert\nset_loop_options\ntf.bitwise\nOverview\nbitwise_and\nbitwise_or\nbitwise_xor\ninvert\nleft_shift\nright_shift\ntf.compat\nOverview\nas_bytes\nas_str\nas_str_any\nas_text\ndimension_at_index\ndimension_value\nforward_compatibility_horizon\nforward_compatible\npath_to_str\nv1\nOverview\nAttrValue\nAttrValue.ListValue\nConditionalAccumulator\nConditionalAccumulatorBase\nConfigProto\nConfigProto.DeviceCountEntry\nConfigProto.Experimental\nDeviceSpec\nDimension\nEvent\nFixedLengthRecordReader\nGPUOptions\nGPUOptions.Experimental\nGPUOptions.Experimental.VirtualDevices\nGraphDef\nGraphKeys\nGraphOptions\nHistogramProto\nIdentityReader\nInteractiveSession\nLMDBReader\nLogMessage\nMetaGraphDef\nMetaGraphDef.CollectionDefEntry\nMetaGraphDef.MetaInfoDef\nMetaGraphDef.MetaInfoDef.FunctionAliasesEntry\nMetaGraphDef.SignatureDefEntry\nNameAttrList\nNameAttrList.AttrEntry\nNodeDef\nNodeDef.AttrEntry\nNodeDef.ExperimentalDebugInfo\nOptimizerOptions\nPrint\nReaderBase\nRunMetadata\nRunMetadata.FunctionGraphs\nRunOptions\nRunOptions.Experimental\nRunOptions.Experimental.RunHandlerPoolOptions\nSession\nSessionLog\nSparseConditionalAccumulator\nSparseTensorValue\nSummary\nSummary.Audio\nSummary.Image\nSummary.Value\nSummaryMetadata\nSummaryMetadata.PluginData\nTFRecordReader\nTensorInfo\nTensorInfo.CompositeTensor\nTensorInfo.CooSparse\nTextLineReader\nVariable\nVariableAggregation\nVariableScope\nWholeFileReader\nadd_check_numerics_ops\nadd_to_collection\nadd_to_collections\nall_variables\narg_max\narg_min\nargmax\nargmin\nassert_equal\nassert_greater\nassert_greater_equal\nassert_integer\nassert_less\nassert_less_equal\nassert_near\nassert_negative\nassert_non_negative\nassert_non_positive\nassert_none_equal\nassert_positive\nassert_rank\nassert_rank_at_least\nassert_rank_in\nassert_scalar\nassert_type\nassert_variables_initialized\nassign\nassign_add\nassign_sub\nbatch_gather\nbatch_scatter_update\nbatch_to_space\nbatch_to_space_nd\nbincount\nboolean_mask\ncase\nclip_by_average_norm\ncolocate_with\ncond\nconfusion_matrix\nconstant\ncontainer\ncontrol_flow_v2_enabled\nconvert_to_tensor\nconvert_to_tensor_or_indexed_slices\nconvert_to_tensor_or_sparse_tensor\ncount_nonzero\ncount_up_to\ncreate_partitioned_variables\ndecode_csv\ndecode_raw\ndelete_session_tensor\ndepth_to_space\ndevice\ndisable_control_flow_v2\ndisable_eager_execution\ndisable_resource_variables\ndisable_tensor_equality\ndisable_v2_behavior\ndisable_v2_tensorshape\nenable_control_flow_v2\nenable_eager_execution\nenable_resource_variables\nenable_tensor_equality\nenable_v2_behavior\nenable_v2_tensorshape\nexecuting_eagerly\nexecuting_eagerly_outside_functions\nexpand_dims\nextract_image_patches\nfixed_size_partitioner\nfloor_div\nfoldl\nfoldr\ngather\ngather_nd\nget_collection\nget_collection_ref\nget_default_graph\nget_default_session\nget_local_variable\nget_seed\nget_session_handle\nget_session_tensor\nget_variable\nget_variable_scope\nglobal_variables\nglobal_variables_initializer\ngradients\nhessians\ninitialize_all_tables\ninitialize_all_variables\ninitialize_local_variables\ninitialize_variables\nis_variable_initialized\nload_file_system_library\nlocal_variables\nlocal_variables_initializer\nmake_template\nmap_fn\nmin_max_variable_partitioner\nmodel_variables\nmoving_average_variables\nmultinomial\nno_regularizer\nnorm\nones_like\nop_scope\npad\nparse_example\nparse_single_example\nplaceholder\nplaceholder_with_default\npy_func\nquantize_v2\nrandom_normal_initializer\nrandom_poisson\nrandom_uniform_initializer\nreduce_all\nreduce_any\nreduce_join\nreduce_logsumexp\nreduce_max\nreduce_mean\nreduce_min\nreduce_prod\nreduce_sum\nreport_uninitialized_variables\nreset_default_graph\nresource_variables_enabled\nreverse_sequence\nscalar_mul\nscan\nscatter_add\nscatter_div\nscatter_max\nscatter_min\nscatter_mul\nscatter_nd_add\nscatter_nd_sub\nscatter_nd_update\nscatter_sub\nscatter_update\nserialize_many_sparse\nserialize_sparse\nset_random_seed\nsetdiff1d\nshape\nsize\nspace_to_batch\nspace_to_depth\nsparse_add\nsparse_concat\nsparse_matmul\nsparse_merge\nsparse_placeholder\nsparse_reduce_max\nsparse_reduce_max_sparse\nsparse_reduce_sum\nsparse_reduce_sum_sparse\nsparse_segment_mean\nsparse_segment_sqrt_n\nsparse_segment_sum\nsparse_split\nsparse_to_dense\nsqueeze\nstring_split\nstring_to_hash_bucket\nstring_to_number\nsubstr\ntables_initializer\nto_bfloat16\nto_complex128\nto_complex64\nto_double\nto_float\nto_int32\nto_int64\ntrainable_variables\ntranspose\ntruncated_normal_initializer\ntuple\nuniform_unit_scaling_initializer\nvariable_axis_size_partitioner\nvariable_creator_scope\nvariable_op_scope\nvariable_scope\nvariables_initializer\nverify_tensor_all_finite\nwhere\nwhile_loop\nwrap_function\nz", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/eaf18c08-52e5-47f5-99e5-4e9316bfe774", "content_hash": "dfe5bd6e6d6a9b79d690cdf93ab1b2c00c5b10b975a362969a9d0d856237d99b", "created_at": "2026-03-28T05:11:12.170747130Z"}
{"id": "f1993be5-0fdc-4988-b882-a6f3d9cab61b", "source": "brain", "text": "Convalida dei dati utilizzando TFX Pipeline e TensorFlow Data Validation\n\nConvalida dei dati utilizzando TFX Pipeline e TensorFlow Data Validation\nPassa ai contenuti principali\nInstalla Apprendimento\nPresentazione\nNuovo su TensorFlow?\nTutorial\nScopri come utilizzare TensorFlow con esempi end-to-end\nGuida\nImpara i concetti e i componenti del framework\nImpara ML\nRisorse formative per padroneggiare il tuo percorso con TensorFlow\nAPI\nTensorFlow (v2.16.1)\nVersions\u2026\nTensorFlow.js\nTensorFlow Lite\nTFX\nEcosistema\nBIBLIOTECHE\nTensorFlow.js\nSviluppa applicazioni Web ML in JavaScript\nTensorFlow Lite\nDistribuisci il machine learning su dispositivi mobili, microcontrollori e altri dispositivi edge\nTFX\nCostruisci pipeline di machine learning di produzione\nTutte le librerie\nCrea modelli avanzati ed estendi TensorFlow\nRISORSE\nModelli e set di dati\nModelli e set di dati pre-addestrati creati da Google e dalla community\nStrumenti\nStrumenti per supportare e accelerare i flussi di lavoro TensorFlow\nAI responsabile\nRisorse per ogni fase del flusso di lavoro ML\nSistemi di consigli\nCostruisci sistemi di consigli con strumenti open source\nCommunity\nGruppi\nGruppi di utenti, gruppi di interesse e mailing list\nContribuisci\nGuida per contribuire al codice e alla documentazione\nBlog\nRimani aggiornato su tutto ci\u00f2 che riguarda TensorFlow\nForum\nPiattaforma di discussione per la comunit\u00e0 TensorFlow\nPerch\u00e9 TensorFlow\nInformazioni\nCase study\n/\nEnglish\nEspa\u00f1ol \u2013 Am\u00e9rica Latina\nFran\u00e7ais\nIndonesia\nItaliano\nPolski\nPortugu\u00eas \u2013 Brasil\nTi\u00ea\u0301ng Vi\u00ea\u0323t\nT\u00fcrk\u00e7e\n\u0420\u0443\u0441\u0441\u043a\u0438\u0439\n\u05e2\u05d1\u05e8\u05d9\u05ea\n\u0627\u0644\u0639\u0631\u0628\u064a\u0651\u0629\n\u0641\u0627\u0631\u0633\u06cc\n\u0939\u093f\u0902\u0926\u0940\n\u09ac\u09be\u0982\u09b2\u09be\n\u0e20\u0e32\u0e29\u0e32\u0e44\u0e17\u0e22\n\u4e2d\u6587 \u2013 \u7b80\u4f53\n\u65e5\u672c\u8a9e\n\ud55c\uad6d\uc5b4\nGitHub Accedi\nFor Production\nPanoramica Tutorial Guida Componenti aggiuntivi TFX API\nInstalla\nApprendimento\nAltro\nPanoramica\nTutorial\nGuida\nComponenti aggiuntivi TFX\nAPI\nAPI\nAltro\nEcosistema\nAltro\nCommunity\nAltro\nPerch\u00e9 TensorFlow\nAltro\nGitHub\nInizia con TFX\nTFX: tutorial introduttivi\n1. Gasdotto di avviamento\n2. Aggiunta della convalida dei dati\n3. Aggiunta dell'ingegneria delle funzionalit\u00e0\n4. Aggiunta dell'analisi del modello\nTFX: tutorial interattivi\nTutorial interattivo (TF2 Keras)\nTutorial interattivo (Estimatore)\nTFX su Google Cloud\nIn esecuzione su tubazioni Vertex\nLeggere i dati da BigQuery\nVertex AI Addestramento e servizio\nTutorial Cloud AI Platform Pipelines\nTFX: tutorial avanzati\nMessa a punto e conversione LLM\nEsercitazione sui componenti personalizzati\nConsigli con TFX\nClassifica con TFX\nTutorial sul flusso d'aria\nApprendimento strutturato neurale in TFX\nConvalida dei dati\nInizia con TFDV\nTrasforma\nPreelabora i dati (principiante)\nPreelabora i dati (avanzato)\nPreelaborazione dei dati per ML con Google Cloud\nAnalisi del modello\nInizia con TFMA\nEsercitazione sugli indicatori di equit\u00e0\nDistribuire un modello addestrato\nServer: TFX per TensorFlow Serving\nMobile e IoT: TFX per TensorFlow Lite\nMetadati ML\nInizia con MLMD\nPresentazione\nTutorial\nGuida\nImpara ML\nTensorFlow (v2.16.1)\nVersions\u2026\nTensorFlow.js\nTensorFlow Lite\nTFX\nBIBLIOTECHE\nTensorFlow.js\nTensorFlow Lite\nTFX\nTutte le librerie\nRISORSE\nModelli e set di dati\nStrumenti\nAI responsabile\nSistemi di consigli\nGruppi\nContribuisci\nBlog\nForum\nInformazioni\nCase study\nTensorFlow\nApprendimento\nFor Production\nTutorial\nConvalida dei dati utilizzando TFX Pipeline e TensorFlow Data Validation Mantieni tutto organizzato con le raccolte Salva e classifica i contenuti in base alle tue preferenze.\nNota: Si consiglia di eseguire questo tutorial in un notebook Colab, con nessuna installazione richiesta! Basta fare clic su \"Esegui in Google Colab\".\nVisualizza su TensorFlow.org Esegui in Google Colab Visualizza la fonte su GitHub Scarica taccuino\nIn questo tutorial basato su notebook, creeremo ed eseguiremo pipeline TFX per convalidare i dati di input e creare un modello ML. Questo notebook \u00e8 basato sul gasdotto TFX abbiamo costruito in semplice TFX Pipeline Tutorial . Se non hai ancora letto quel tutorial, dovresti leggerlo prima di procedere con questo taccuino.\nLa prima attivit\u00e0 in qualsiasi data science o progetto ML \u00e8 comprendere e pulire i dati, che includono:\nComprendere i tipi di dati, le distribuzioni e altre informazioni (ad esempio, valore medio o numero di univoci) su ciascuna caratteristica\nGenerazione di uno schema preliminare che descrive i dati\nIdentificazione di anomalie e valori mancanti nei dati rispetto a uno schema dato\nIn questo tutorial creeremo due pipeline TFX.\nInnanzitutto, creeremo una pipeline per analizzare il set di dati e generare uno schema preliminare del set di dati specificato. Questo gasdotto comprender\u00e0 due nuovi componenti, StatisticsGen e SchemaGen .\nUna volta che avremo uno schema corretto dei dati, creeremo una pipeline per addestrare un modello di classificazione ML basato sulla pipeline del tutorial precedente. In questo gasdotto, useremo lo schema dalla prima pipeline e un nuovo componente, ExampleValidator , per convalidare i dati di input.\nI tre nuovi componenti, StatisticsGen, SchemaGen e ExampleValidator, sono componenti TFX per l'analisi dei dati e la validazione, e la loro applicazione utilizzando il tensorflow Data Validation biblioteca.\nSi prega di consultare Capire TFX Pipelines per conoscere meglio i vari concetti in TFX.\nImpostare\nPer prima cosa dobbiamo installare il pacchetto TFX Python e scaricare il set di dati che utilizzeremo per il nostro modello.\nAggiorna Pip\nPer evitare di aggiornare Pip in un sistema durante l'esecuzione in locale, verificare che stiamo eseguendo in Colab. I sistemi locali possono ovviamente essere aggiornati separatamente.\ntry:\n import colab\n !pip install --upgrade pip\nexcept:\n pass\nInstalla TFX\n\npip install -U tfx\nHai riavviato il runtime?\nSe stai utilizzando Google Colab, la prima volta che esegui la cella in alto, devi riavviare il runtime facendo clic sul pulsante \"RIAVVIA RUNTIME\" sopra o utilizzando il menu \"Runtime > Riavvia runtime ...\". Ci\u00f2 \u00e8 dovuto al modo in cui Colab carica i pacchetti.\nControlla le versioni TensorFlow e TFX.\nimport tensorflow as tf\nprint('TensorFlow version: {}'.format(tf.__version__))\nfrom tfx import v1 as tfx\nprint('TFX version: {}'.format(tfx.__version__))\n\nTensorFlow version: 2.6.2\nTFX version: 1.4.0\nImposta variabili\nCi sono alcune variabili usate per definire una pipeline. Puoi personalizzare queste variabili come desideri. Per impostazione predefinita, tutto l'output dalla pipeline verr\u00e0 generato nella directory corrente.\nimport os\n\n# We will create two pipelines. One for schema generation and one for training.\nSCHEMA_PIPELINE_NAME = \"penguin-tfdv-schema\"\nPIPELINE_NAME = \"penguin-tfdv\"\n\n# Output directory to store artifacts generated from the pipeline.\nSCHEMA_PIPELINE_ROOT = os.path.join('pipelines', SCHEMA_PIPELINE_NAME)\nPIPELINE_ROOT = os.path.join('pipelines', PIPELINE_NAME)\n# Path to a SQLite DB file to use as an MLMD storage.\nSCHEMA_METADATA_PATH = os.path.join('metadata', SCHEMA_PIPELINE_NAME,\n 'metadata.db')\nMETADATA_PATH = os.path.join('metadata', PIPELINE_NAME, 'metadata.db')\n\n# Output directory where created models from the pipeline will be exported.\nSERVING_MODEL_DIR = os.path.join('serving_model', PIPELINE_NAME)\n\nfrom absl import logging\nlogging.set_verbosity(logging.INFO) # Set default logging level.\nPrepara dati di esempio\nScaricheremo il set di dati di esempio da utilizzare nella nostra pipeline TFX. Il set di dati che stiamo usando \u00e8 Palmer Penguins set di dati che viene utilizzato anche in altri esempi TFX .\nCi sono quattro caratteristiche numeriche in questo set di dati:\nculmen_length_mm\nculmen_depth_mm\nflipper_length_mm\nbody_mass_g\nTutte le caratteristiche erano gi\u00e0 normalizzate per avere un intervallo [0,1]. Costruiremo un modello di classificazione che prevede le species di pinguini.\nPoich\u00e9 il componente TFX ExampleGen legge gli input da una directory, \u00e8 necessario creare una directory e copiarvi il set di dati.\nimport urllib.request\nimport tempfile\n\nDATA_ROOT = tempfile.mkdtemp(prefix='tfx-data') # Create a temporary directory.\n_data_url = 'https://raw.githubusercontent.com/tensorflow/tfx/master/tfx/examples/penguin/data/label", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/f1993be5-0fdc-4988-b882-a6f3d9cab61b", "content_hash": "cec10a01f851ad18646e2f68736f5a3e52944035c5f181ac887fb672223b2d4e", "created_at": "2026-03-28T05:11:11.636874659Z"}
{"id": "c436036b-9b84-42e0-8685-695f42639f35", "source": "brain", "text": "NHANES August 2021-August 2023 Laboratory Methods\n\nNHANES August 2021-August 2023 Laboratory Methods\nSkip directly to site content\nCenters for Disease Control and Prevention. CDC twenty four seven. Saving Lives, Protecting People Centers for Disease Control and Prevention. CDC twenty four seven. Saving Lives, Protecting People\nNational Center for Health Statistics\nSection Navigation National Health and Nutrition Examination Survey\nAbout NHANES plus icon\nVideo: The NHANES Story\nWhat We Eat in America, Dietary Survey\nMeet the Directors\nNewsletters plus icon\n2010 NHANES Stakeholders Consortium Presentations\nEthics Review Board (ERB) Approval\nWhat's New plus icon\nArchive\nQuestionnaires, Datasets, and Related Documentation plus icon\nSurvey Methods and Analytic Guidelines\nData User Agreement\nSearch Variables\nFrequently Asked Questions\nAll Continuous NHANES plus icon\nAll Demographics Data\nAll Dietary Data\nAll Examination Data\nAll Laboratory Data\nAll Questionnaire Data\nAll Limited Access Data\nNHANES 2025-2026 plus icon\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nBrief Overview and Analytic Guidance\nWhat We Eat in America, NHANES Dietary Data: Notice to Users\nRelease Notes\nNHANES 08/2021-08/2023 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nBrief Overview and Analytic Guidance\nWhat We Eat in America, NHANES Dietary Data: Notice to Users\nRelease Notes\nNHANES 2017-March 2020 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nBrief Overview and Analytic Guidance\nRelease Notes\nNHANES 2019-2020 plus icon\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nNHANES 2017-2018 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nOverview\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2015-2016 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nOverview\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2013-2014 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nOverview\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2011-2012 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nOverview\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2009-2010 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2007-2008 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nRelease Notes\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNote on 2007-2010 Sampling Methodology\nNHANES 2005-2006 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2003-2004 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 2001-2002 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES 1999-2000 plus icon\nDemographics Data\nDietary Data\nExamination Data\nLaboratory Data\nQuestionnaire Data\nLimited Access Data\nQuestionnaire Instruments\nLaboratory Methods\nProcedure Manuals\nBrochures and Consent Documents\nDocumentation Contents\nLaboratory Data Overview\nQuestionnaire Data Overview\nExamination Data Overview\nNHANES III plus icon\nReference Manuals and Report\nAnthropometric Procedure Videos\nSurvey Methods and Analytic Guidelines\nNHANES III Public Use Data Files Errata\nSerum Latex Allergy (IgE) Data Analysis Issues\nData Files\nHispanic HANES plus icon\nReference Manuals and Report\nSurvey Methods and Analytic Guidelines\nNHANES II plus icon\nReference Manuals and Report\nSurvey Methods and Analytic Guidelines\nNHANES I plus icon\nReference Manuals and Reports\nSurvey Methods and Analytic Guidelines\nNHES III plus icon\nReference Manuals and Reports\nSurvey Methods and Analytic Guidelines\nNHES II plus icon\nReference Manuals and Reports\nSurvey Methods and Analytic Guidelines\nNHES I plus icon\nReference Manuals and Reports\nSurvey Methods and Analytic Guidelines\nMeasuring Guides for the Dietary Recall Interview\nResponse Rates and Population Totals\nSAS Viewer\nSurvey Participants plus icon\nParticipation plus icon\nEnglish\nVietnamese Translation\nSimplified Chinese Translation\nTraditional Chinese Translation\nKorean Translation\nSpanish Translation\nFrench Translation\nHaitian Creole Translation\nAmharic Translation\nHindi Translation\nWhy I was selected\nBenefits of Participating\nInformation Collected\nConfidentiality\nAbout NHANES\nBiospecimen Program plus icon\nDNA Specimens and Genetic Data\nSerum, Plasma, and Urine Specimens\nPublications using DNA Specimens\nPublications using Serum, Plasma, and Urine Specimens\nInformation for Participants\nNew Content and Proposal Guidelines\nSurvey Results and Products plus icon\nOverview of Data Accomplishments from NHANES\nTutorials plus icon\nDatasets and Documentation Module\nSample Design Module\nWeighting Module\nVariance Estimation Module\nReliability of Estimates Module\nNHANES Dietary Analyses Module\nSample Code\nSoftware Tips\nListserv\nInformation for Health Professionals\nContact Us\nCDC\nFacebook\nTwitter\nLinkedIn\nEmail\nSyndicate\nNHANES August 2021-August 2023 Laboratory Methods\nminus\nRelated Pages\nYears\nLab Method Name\nDocumentation\nRelease Date\n2021-2023 Alanine Aminotransferase (ALT) [PDF - 976 KB] September 2025\n2021-2023 Albumin [PDF - 970 KB] September 2025\n2021-2023 Alkaline Phosphatase (ALP) [PDF - 937 KB] September 2025\n2021-2023 alpha-1-Acid Glycoprotein [PDF - 1.35 MB] September 2024\n2021-2023 Anti-M\u00fcllerian Hormone [PDF - 1.23 MB] October 2024\n2021-2023 Aspartate Aminotransferase (AST) [PDF - 945 KB] September 2025\n2021-2023 Bicarbonate [PDF - 1.04 MB] September 2025\n2021-2023 Blood Lead, Cadmium, Total Mercury, Selenium and Manganese [PDF - 6.16 MB] September 2024\n2021-2023 Blood Urea Nitrogen (BUN) [PDF - 937 KB] September 2025\n2021-2023 Chloride [PDF - 0.97 MB] September 2025\n2021-2023 Complete Blood Count [PDF - 48.2 MB] September 2024\n2021-2023 Creatinine [PDF - 693 KB] September 2025\n2021-2023 Creatinine Phosphokinase (CPK) [PDF - 944 KB] September 2025\n2021-2023 Fa", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/c436036b-9b84-42e0-8685-695f42639f35", "content_hash": "c65362310b1d3ee4fb2ab65ca836bd318961d1d45f4a55e7e604b12a676c2542", "created_at": "2026-03-28T05:11:11.614583727Z"}
{"id": "b2caa079-b4f5-4f79-bc80-b22df69c60a5", "source": "brain", "text": "TXN2 thioredoxin 2 [Homo sapiens (human)] - Gene - NCBI\n\nTXN2 thioredoxin 2 [Homo sapiens (human)] - Gene - NCBI\nWarning: The NCBI web site requires JavaScript to function. more...\nAn official website of the United States government\nHere's how you know\nThe .gov means it's official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard\nPublications\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nGene\nGenes and mapped phenotypes\nSearch database All DatabasesAssemblyBiocollectionsBioProjectBioSampleBooksClinVarConserved DomainsdbGaPdbVarGeneGenomeGEO DataSetsGEO ProfilesGTRIdentical Protein GroupsMedGenMeSHNLM CatalogNucleotideOMIMPMCProteinProtein ClustersProtein Family ModelsPubChem BioAssayPubChem CompoundPubChem SubstancePubMedSNPSRAStructureTaxonomyToolKitToolKitAllToolKitBookgh\nSearch term\nSearch\nAdvanced\nHelp\nResult Filters\nGene sources\nClear\nGenomic\nCategories\nClear\nAlternatively spliced\nAnnotated genes\nProtein-coding\nSequence content\nClear\nCCDS\nEnsembl\nRefSeq\nRefSeqGene\nStatus\nClear\nCurrent(1)\nChromosome locations\nClear\nmore...\nChromosome locations\nSelect an organism by typing or scrolling\nChromosome\nFrom\nTo\nApply\nClear all\nShow additional filters\nx\nAdditional filters\nGene sources\nCategories\nSequence content\nStatus\nChromosome locations\nSearch fields\nShow\nS I D E B A R\nFull Report\nFormat\nFull Report\nFull Report (text)\nExpression\nGene Table\nGene Table (text)\nGeneRIF\nSummary\nSummary (text)\nTabular\nTabular (text)\nASN.1\nXML\nUI List\nApply\nSend to:\nChoose Destination\nFile\nClipboard\nCollections\nFormat Full Report (text)Gene Table (text)Summary (text)Tabular (text)ASN.1XMLUI List\nCreate File\nAdd to Clipboard\nAdd to Collections\nTXN2 thioredoxin 2 [ Homo sapiens (human) ]\nGene ID: 25828, updated on 18-Jan-2026\nDownload Datasets\nGene Sequences (FASTA)\nTranscript sequences (FASTA)\nProtein sequences(FASTA)\nIn addition, your package will include a detailed data report in both TSV and JSONL formats.\nFile name\nDownload\nSummary\nGo to the top of the page Help\nOfficial Symbol\nTXN2provided by HGNC\nOfficial Full Name\nthioredoxin 2provided by HGNC\nPrimary source\nHGNC:HGNC:17772\nSee related\nEnsembl:ENSG00000100348 MIM:609063; AllianceGenome:HGNC:17772\nGene type\nprotein coding\nRefSeq status\nREVIEWED\nOrganism\nHomo sapiens\nLineage\nEukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo\nAlso known as\nTXN; MTRX; TRX2; MT-TRX; COXPD29\nSummary\nThis nuclear gene encodes a mitochondrial member of the thioredoxin family, a group of small multifunctional redox-active proteins. The encoded protein may play important roles in the regulation of the mitochondrial membrane potential and in protection against oxidant-induced apoptosis. [provided by RefSeq, Jul 2008]\nExpression\nUbiquitous expression in adrenal (RPKM 39.7), kidney (RPKM 28.5) and 25 other tissues See more\nOrthologs\nall\nTry the new Gene page\nTry the new Transcripts and proteins table\nGenomic context\nGo to the top of the page Help\nSee TXN2 in Genome Data Viewer\nLocation:\n22q12.3\nExon count:\n4\nAnnotation release\nStatus\nAssembly\nChr\nLocation\nRS_2025_08 current GRCh38.p14 (GCF_000001405.40) 22 NC_000022.11 (36467046..36481640, complement)\nRS_2025_08 current T2T-CHM13v2.0 (GCF_009914755.1) 22 NC_060946.1 (36927219..36941813, complement)\nRS_2024_09 previous assembly GRCh37.p13 (GCF_000001405.25) 22 NC_000022.10 (36863093..36877687, complement)\nChromosome 22 - NC_000022.11\nGenomic regions, transcripts, and products\nGo to the top of the page Help\nGo to reference sequence details\nGenomic Sequence: NC_000022.11 Chromosome 22 Reference GRCh38.p14 Primary Assembly NG_046718.1 RefSeqGene NC_060946.1 Chromosome 22 Alternate T2T-CHM13v2.0 NC_000022.10 Chromosome 22 Reference GRCh37.p13 Primary Assembly\nGo to nucleotide: Graphics FASTA GenBank\nExpression\nGo to the top of the page Help\nSee details\nTissue-specific circular RNA induction during human fetal development RNA sequencing of total RNA from 20 human tissues HPA RNA-seq normal tissues\nProject title: Tissue-specific circular RNA induction during human fetal development\nDescription: 35 human fetal samples from 6 tissues (3 - 7 replicates per tissue) collected between 10 and 20 weeks gestational time were sequenced using Illumina TruSeq Stranded Total RNA\nBioProject: PRJNA270632\nPublication: PMID 26076956\nAnalysis date: Mon Apr 2 22:54:59 2018\nBibliography\nGo to the top of the pageHelp\nRelated articles in PubMed\nHypoxia inhibits expression and function of mitochondrial thioredoxin 2 to promote pulmonary hypertension. Adesina SE, et al. Am J Physiol Lung Cell Mol Physiol, 2017 May 1. PMID 28130258, Free PMC Article\nHuman mitochondrial thioredoxin. Involvement in mitochondrial membrane potential and cell death. Damdimopoulos AE, et al. J Biol Chem, 2002 Sep 6. PMID 12080052\nThioredoxin 2 Offers Protection against Mitochondrial Oxidative Stress in H9c2 Cells and against Myocardial Hypertrophy Induced by Hyperglycemia. Li H, et al. Int J Mol Sci, 2017 Sep 15. PMID 28914755, Free PMC Article\nGenetic polymorphisms in the thioredoxin 2 (TXN2) gene and risk for spina bifida. Wen S, et al. Am J Med Genet A, 2009 Feb. PMID 19165900, Free PMC Article\nThioredoxin 2 Is a Novel E2-Interacting Protein That Inhibits the Replication of Classical Swine Fever Virus. Li S, et al. J Virol, 2015 Aug. PMID 26041303, Free PMC Article\nSee all (68) citations in PubMed\nGeneRIFs: Gene References Into Functions\nWhat's a GeneRIF?\nscAAV2-Mediated Expression of Thioredoxin 2 and C3 Transferase Prevents Retinal Ganglion Cell Death and Lowers Intraocular Pressure in a Mouse Model of Glaucoma.\nTitle: scAAV2-Mediated Expression of Thioredoxin 2 and C3 Transferase Prevents Retinal Ganglion Cell Death and Lowers Intraocular Pressure in a Mouse Model of Glaucoma.\nAssociation between genetic variants in oxidative stress-related genes and osteoporotic bone fracture. The Hortega follow-up study.\nTitle: Association between genetic variants in oxidative stress-related genes and osteoporotic bone fracture. The Hortega follow-up study.\nMitochondrial TXN2 attenuates amyloidogenesis via selective inhibition of BACE1 expression.\nTitle: Mitochondrial TXN2 attenuates amyloidogenesis via selective inhibition of BACE1 expression.\nMechanisms of Trx2/ASK1-Mediated Mitochondrial Injury in Pemphigus Vulgaris.\nTitle: Mechanisms of Trx2/ASK1-Mediated Mitochondrial Injury in Pemphigus Vulgaris.\nThioredoxin 2 Negatively Regulates Innate Immunity to RNA Viruses by Disrupting the Assembly of the Virus-Induced Signaling Adaptor Complex.\nTitle: Thioredoxin 2 Negatively Regulates Innate Immunity to RNA Viruses by Disrupting the Assembly of the Virus-Induced Signaling Adaptor Complex.\nOverexpression of mitochondrial Trx2 attenuates the intracellular ROS accumulation and ATP production. Most interestingly, mitochondrial Trx2 may be involved in the cardiac hypertrophy signaling of diabetes.\nTitle: Thioredoxin 2 Offers Protection against Mitochondrial Oxidative Stress in H9c2 Cells and against Myocardial Hypertrophy Induced by Hyperglycemia.\nPrx3 and Trx2 comprise an adaptive system to sense changes in atmospheric oxygen tension and influence cellular injury responses through both detoxification of mitochondrial oxidants and regulation of mitochondrial redox-dependent signaling\nTitle: Detoxification of Mitochondrial Oxidants and Apoptotic Signaling Are Facilitated by Thioredoxin-2 and Peroxiredoxin-3 during Hyperoxic Injury.\nTrx2 overexpression failed to attenuate hypoxia-induced human pulmonary arterial smooth muscle cells proliferation in vitro or hypoxia-induced Pulmonary hypertension in vivo.\nTitle: Hypoxia inhibits expression and function o", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/b2caa079-b4f5-4f79-bc80-b22df69c60a5", "content_hash": "42ae8e6503eaea4cd024c94f852f6f1eb022af002c693e6d023ba216e6b89c2b", "created_at": "2026-03-28T05:11:11.557449048Z"}
{"id": "6590e995-db9d-41d3-a025-cc14ec2e91a9", "source": "brain", "text": "Isolate Details | Antimicrobial Resistance Isolate Bank | Antibiotic/Antimicrobial Resistance | CDC\n\nIsolate Details | Antimicrobial Resistance Isolate Bank | Antibiotic/Antimicrobial Resistance | CDC\nSkip directly to site content\nAre You Still There?\nDue to inactivity, you will be signed out in two minutes unless you click 'Continue'.\nContinue\nAre you still there?\nDue to inactivity, you will be signed out in two minutes unless\nyou click 'Continue'.\nContinue\nSign In Register to Create an Account\nMENU\nA\nB\nC\nStart of Search Controls\nSearch Form Controls\nsubset checkbox\nCancel\nSubmit\nSearch The CDC\nCDC & FDA Antimicrobial Resistance Isolate Bank\nNote: Javascript is disabled or is not supported by your browser. For this reason, some items on this page will be unavailable. For more information about this message, please visit this page: About CDC.gov.\nAR Isolate Bank Home\nAbout the Bank\nNavigating the Website\nQuestions & Answers\nShipping Information\nAR Isolate Bank Citations\nAll Isolate Panels\nIsolate Search\nContact Us\nView another isolate in this panel > View Another Isolate 0034 - Klebsiella pneumoniae 0040 - Klebsiella pneumoniae 0045 - Acinetobacter baumannii 0054 - Pseudomonas aeruginosa 0056 - Acinetobacter baumannii 0060 - Enterobacter cloacae 0064 - Pseudomonas aeruginosa 0075 - Klebsiella pneumoniae 0078 - Acinetobacter baumannii 0083 - Acinetobacter baumannii 0088 - Acinetobacter baumannii 0090 - Pseudomonas aeruginosa 0092 - Pseudomonas aeruginosa 0095 - Pseudomonas aeruginosa 0098 - Klebsiella pneumoniae 0100 - Pseudomonas aeruginosa 0104 - Escherichia coli 0105 - Pseudomonas aeruginosa 0118 - Escherichia coli 0132 - Enterobacter cloacae group 0143 - Klebsiella pneumoniae 0150 - Escherichia coli 0151 - Escherichia coli 0155 - Proteus mirabilis 0159 - Proteus mirabilis 0162 - Escherichia coli 0239 - Pseudomonas aeruginosa 0241 - Pseudomonas aeruginosa 0246 - Pseudomonas aeruginosa 0274 - Acinetobacter baumannii 0285 - Acinetobacter baumannii 0288 - Acinetobacter baumannii 0309 - Acinetobacter baumannii 0517 - Serratia marcescens 0555 - Klebsiella pneumoniae 0858 - Enterobacter cloacae\nPanel: Cefiderocol Verification (FDC) (Custom)\nAR Bank # 0033 Acinetobacter baumannii\nStudy ID: CarbaNP-02\nBiosample Accession #: SAMN04014874\nMLST: ST85(Pasteur), ST1089(Oxford)\nThis panels contains isolates from other AR Bank collections/panels.\nMICs obtained by broth microdilution. Modal MIC is reported.\nMIC results for each antimicrobial agent for an isolate may commonly be \u00b1 1 log2 (doubling dilution) different than what is posted on the FDA & CDC AR Bank website because this is the normal technical variability of antimicrobial susceptibility testing (see J. H. Jorgensen. 1993. J Clin Microbiol. Vol 31[11]: 2841-2844).\nPanel: Gram Negative Carbapenemase Detection (CarbaNP) | ARLN Verification (Custom) | Cefiderocol Verification (FDC) (Custom) | GN7F ARLN (Custom) | GAIHN (Custom)\nMIC\nMMR\nPropagation\nTemp & Biosafety\nIsolate History\nMIC (\u03bcg/ml) Results and Interpretation\nDrug\nMIC (\u03bcg/ml)\nINT\nAmikacin 2 S\nAmpicillin/sulbactam 1 >32 R\nCefepime >32 R\nCefepime/zidebactam 5 >64 ---\nCefiderocol 16 R\nCefotaxime >64 R\nCeftazidime >128 R\nCeftriaxone >32 R\nCiprofloxacin >8 R\nColistin 4 1 I\nDoripenem >8 R\nGentamicin 16 R\nImipenem 64 R\nImipenem+chelators 3 4 ---\nLevofloxacin 8 R\nMeropenem >8 R\nMinocycline <=4 S\nPiperacillin/tazobactam 1 >128 R\nTetracycline <=2 S\nTigecycline 2 <=0.5 ---\nTobramycin 16 R\nTrimethoprim/sulfamethoxazole 1 >8 R\n1 Reflects MIC of first component\n2 Based on FDA break points\n3 Screen for metallo-beta-lactamase production [Rasheed et al. Emerging Infectious Diseases. 2013. 19(6):870-878]\n4 Clinical and PK/PD data demonstrate colistin has limited clinical efficacy, even if an intermediate result is obtained. Alternative agents are strongly preferred. Colistin should be used in combination with one or more active antimicrobial agents. Consultation with an infectious disease specialist is recommended.\n5 Cefepime to zidebactam ratio (1:1)\nDevice manufacturers and users of FDA cleared devices shall consult the FDA\u2019s Antibacterial Susceptibility Test Interpretive Criteria website for breakpoints recognized or recommended by FDA, and for information regarding FDA exceptions or additions to the applicable, recognized consensus standard.\nMolecular Mechanisms of Resistance\nCategory Gene\nAminoglycoside ant(3\")-IIa\nBeta-lactam NDM-1, OXA-94\nBleomycin ble-MBL\nEfflux pumps/Other ABAF\nSulfonamides sul2\nDisclaimer:\nThe resistance mechanisms listed were identified by analysis of whole genome sequence using the ResFinder database (last updated June 2, 2016 and accessed on October 25, 2016). This analysis does not include mutations that may result in antibiotic resistance or resistance determinants added to newer versions of the ResFinder database or other antimicrobial resistance gene databases. Biosample accession numbers have been provided so that users can analyze the data on their own if so desired.\nFor additional gene information please visit the Reference Gene Catalog - Pathogen Detection - NCBI (https://www.ncbi.nlm.nih.gov/pathogens/refgene), a non-redundant database of bacterial genes related to antimicrobial resistance, biocide and stress resistance, general efflux, virulence, or antigenicity.\nPropagation\nMEDIUM\nMedium: Trypticase Soy Agar with 5% Sheep Blood (BAP)\nGROWTH CONDITIONS\nTemperature: 35\u00b0C\nAtmosphere: Aerobic\nPROPAGATION PROCEDURE\nRemove the sample vial to a container with dry ice or a freezer block. Keep vial on ice or block. (Do not let vial content thaw) Open vial aseptically to avoid contamination Using a sterile loop, remove a small amount of frozen isolate from the top of the vial Aseptically transfer the loop to BAP Use streak plate method to isolate single colonies Incubate inverted plate at 35\u00b0C \u00b1 2\u00b0C for 20-24 hrs.\nStorage Temperature & Biosafety\nSTORAGE TEMPERATURE: -70\u00b0C\nBIOSAFETY LEVEL: 2\nAppropriate safety procedures should always be used with this material. Laboratory safety is discussed in the current publication of 'BioSafety in Microbiological and Biomedical Laboratories' from the U.S. Department of Health and Human Services, Centers for Disease Control and Prevention, and National Institutes of Health.\nDisclaimer:\nThis product is sent with the condition that you are responsible for its safe storage, handling, and use. All materials are the property of the Centers for Disease Control and Prevention (CDC) and have been made available on behalf of the Food and Drug Administration (FDA). This material is not for use in human subjects and may not be redistributed. While CDC uses reasonable efforts to include accurate and up-to-date information on this product sheet, CDC makes no warranties or representations as to its accuracy. CDC is not liable for damages arising from the misidentification or misrepresentation of cultures. Please refer to the Standard Letter Agreement (SLA) for further details regarding the use of this product.\nIsolate History\nDate\nAction Performed\n10/18/23 INT was updated with a new value for Minocycline: from '---' to 'S'\n10/18/23 MIC was updated with a new value for Minocycline: from '---' to '<=4'\n10/18/23 Drug was added: Minocycline\n03/09/23 Gene was added to 'ABAF'\n03/09/23 Category was added: 'Efflux pumps/Other'\n03/09/23 Gene was added to 'ble-MBL'\n03/09/23 Gene was added to 'ant(3\")-IIa'\n03/09/23 Category was added: 'Bleomycin'\n03/09/23 Category was added: 'Aminoglycoside'\n12/19/22 MLST was updated: from '---' to 'ST1089(Oxford)'\n12/19/22 MLST was updated: from '---' to 'ST85(Pasteur)'\n12/07/22 MIC was updated with a new value for Cefepime/zidebactam: from '---' to '>64'\n12/07/22 Drug was added: Cefepime/zidebactam\nTop of Page\nFile Formats Help:\nHow do I view different file formats (PDF, DOC, PPT, MPEG) on this site?\nAdobe PDF file\nMicrosoft PowerPoint file\nMicrosoft Word file\nMicrosoft Excel file\nAudio/Video file\nApple Quicktime file\nRealPlayer file\nText file\nZip Archive file\nSAS file\nePub file\nRIS file\nEmail\nRecommend\nTweet\nYouTube\nInstagram\nListen\nWatch\nRSS\nABOUT\nAbout CDC\nJobs\nFunding\nLEGAL\nPolicie", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/6590e995-db9d-41d3-a025-cc14ec2e91a9", "content_hash": "417ffa26be8f4a09425d4b123267b6ea5a8309f4f716cef57ac4b56173828e4a", "created_at": "2026-03-28T05:11:11.437619427Z"}
{"id": "52356910-314a-4d61-841d-dac37c71ef57", "source": "brain", "text": "4273 Willow Draw Drive #606, Park City, UT 84098 | Realty One Group\n\n4273 Willow Draw Drive #606, Park City, UT 84098 | Realty One Group\nPerformAction\n(<PHONE_2>\nSign In / Sign Up\nWHAT\u2019S MY HOME WORTH?\nPROPERTY SEARCH PROPERTY SEARCH\nHIDDEN VALLEY COUNTRY CLUB HIDDEN VALLEY COUNTRY CLUB\n$500K to $1 Mil\nWillow Creek Country Club\nOUR CITIES OUR CITIES\nDuchesne\nRoosevelt\nBOUNTIFUL BOUNTIFUL\nON THE MARKET\nBLUFFDALE BLUFFDALE\nON THE MARKET\nHERRIMAN HERRIMAN\nON THE MARKET\nHOLLADAY HOLLADAY\nON THE MARKET\nMidvale Midvale\nON THE MARKET\nCottonwood Heights Cottonwood Heights\nON THE MARKET\nPARK CITY PARK CITY\nON THE MARKET\nVERNAL VERNAL\nON THE MARKET\nGET APPROVED\nMortgage Calculator\nCONTACT\nWHAT\u2019S MY HOME WORTH?\nPROPERTY SEARCH PROPERTY SEARCH\nHIDDEN VALLEY COUNTRY CLUB HIDDEN VALLEY COUNTRY CLUB\n$500K to $1 Mil\nWillow Creek Country Club\nOUR CITIES OUR CITIES\nDuchesne\nRoosevelt\nBOUNTIFUL BOUNTIFUL\nON THE MARKET\nBLUFFDALE BLUFFDALE\nON THE MARKET\nHERRIMAN HERRIMAN\nON THE MARKET\nHOLLADAY HOLLADAY\nON THE MARKET\nMidvale Midvale\nON THE MARKET\nCottonwood Heights Cottonwood Heights\nON THE MARKET\nPARK CITY PARK CITY\nON THE MARKET\nVERNAL VERNAL\nON THE MARKET\nGET APPROVED\nMortgage Calculator\nCONTACT\nSign In / Sign Up\n(<PHONE_2>\nWHAT\u2019S MY HOME WORTH?\nPROPERTY SEARCH PROPERTY SEARCH\nHIDDEN VALLEY COUNTRY CLUB HIDDEN VALLEY COUNTRY CLUB\n$500K to $1 Mil\nWillow Creek Country Club\nOUR CITIES OUR CITIES\nDuchesne\nRoosevelt\nBOUNTIFUL BOUNTIFUL\nON THE MARKET\nBLUFFDALE BLUFFDALE\nON THE MARKET\nHERRIMAN HERRIMAN\nON THE MARKET\nHOLLADAY HOLLADAY\nON THE MARKET\nMidvale Midvale\nON THE MARKET\nCottonwood Heights Cottonwood Heights\nON THE MARKET\nPARK CITY PARK CITY\nON THE MARKET\nVERNAL VERNAL\nON THE MARKET\nGET APPROVED\nMortgage Calculator\nCONTACT\nWHAT\u2019S MY HOME WORTH?\nPROPERTY SEARCH PROPERTY SEARCH\nHIDDEN VALLEY COUNTRY CLUB HIDDEN VALLEY COUNTRY CLUB\n$500K to $1 Mil\nWillow Creek Country Club\nOUR CITIES OUR CITIES\nDuchesne\nRoosevelt\nBOUNTIFUL BOUNTIFUL\nON THE MARKET\nBLUFFDALE BLUFFDALE\nON THE MARKET\nHERRIMAN HERRIMAN\nON THE MARKET\nHOLLADAY HOLLADAY\nON THE MARKET\nMidvale Midvale\nON THE MARKET\nCottonwood Heights Cottonwood Heights\nON THE MARKET\nPARK CITY PARK CITY\nON THE MARKET\nVERNAL VERNAL\nON THE MARKET\nGET APPROVED\nMortgage Calculator\nCONTACT\nSign Up for a free account to view listing.\n4273 Willow Draw Drive #606, Park City, UT 84098 (Sold on )\nActive\nNew Listing\n2,750,000\n3 + {{Property?.Bedroomsplus}} BedBeds\n4 BathBaths\n2,451 Sq.Ft.Sq.Ft.\nTypeCondo/Townhouse\nActive\nMLS# 12600347\nListing Courtesy of Summit Sotheby's International Realty\nProperty Info\nListing Agent\nMap\nSave Listing\nWebsite\nShare Listing\nVirtual Tour\nProperty Info\nlisting agent\nMap\nWebsite\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\ngallery\nPhotos\nPrint\nRequest Info\nVirtual Tours\nProperty Description\nLocated in the coveted Juniper Landing community at Canyons Village, this thoughtfully upgraded, fully furnished residence offers the perfect blend of modern design, comfort, and convenience. The spacious layout features clean architectural lines, high ceilings, and abundant natural light, creating a warm and refined atmosphere ideal for both everyday living and entertaining. The open-concept living area flows seamlessly into a well-appointed kitchen with sleek finishes, premium appliances, and ample workspace. Numerous upgrades throughout the home include a whole-home humidifier and reverse osmosis water filtration system, enhancing both comfort and quality of living. Step outside on your oversized deck or large private patio with a hot tub, perfect for unwinding after a day on the mountain. Two separate, heated one-car garages provide generous storage for gear and offer added convenience for owners and guests alike. Juniper Landing residents enjoy access to exceptional amenities, including a 25-yard heated outdoor saltwater pool, year-round hot tub, fire pit, fitness center, dry sauna, and steam shower. Ideally situated just a short walk to the Frostwood Gondola, with easy access to skiing, hiking, and biking, this home is a year-round retreat in one of Park City's most desirable locations.\nVisit My Website My Listings Visit Our Website Our Listings\n{{Item.Name}}\n{{Item.ListingMarketLabel}}\n{{Item.LicenseNoPrefix}}{{Item.LicensedNo}}\n{{Item.Office.Street}} {{Item.Office.City}} {{Item.Office.State}} {{Item.Office.Zip}}\nOffice{{Item.PhoneOffice}}\nMobile{{Item.MobilePhone}}\nFax{{Item.Fax}}\nEmail Me\nEmail Us\n{{Item.Name}} {{Item.PhotoUrlForSchema}}?mw=800&mh=500 {{Item.WebsiteUrl}}\n{{Item.PriorityLocation}}\n{{Item.Street}} {{Item.State}} United States {{Item.Zip}}\n{{Item.PriorityPhoneLink}} {{Item.Email}} sales {{Item.State}}\nThank you for requesting a showing of this property. A representative will be in touch with you shortly to confirm the requested showing date and time.\nPlease note that your appointment is not confirmed until someone contacts you.\nRequest Info / Schedule Showing\nFirst Name\nLast Name\nEmail\nPhone\nSelect Office Farmington Office Midvale Office Signature South Valley Office Vernal Office\nI am interested in 4273 Willow Draw Drive #606, Park City, UT 84098\nRemarks\nSchedule Showing\nShowing Date\n8:00 AM 8:30 AM 9:00 AM 9:30 AM 10:00 AM 10:30 AM 11:00 AM 11:30 AM 12:00 PM 12:30 PM 1:00 PM 1:30 PM 2:00 PM 2:30 PM 3:00 PM 3:30 PM 4:00 PM 4:30 PM 5:00 PM 5:30 PM 6:00 PM 6:30 PM 7:00 PM 7:30 PM 8:00 PM Showing Time\nSubmit\nProperty Details 4273 Willow Draw Drive #606, Park City, UT 84098\nGeneral\n{{Item.Label}}: {{Item.Value}}\nInterior Features\n{{Item.Label}}: {{Item.Value}}\nExterior Features\n{{Item.Label}}: {{Item.Value}}\nAdditional Features\n{{Item.Label}}: {{Item.Value}}\nSchools\n{{Item.Label}}: {{Item.Value}}\nAgent Compensation\n{{Item.Label}}: {{Item.Value}}\nFinancial Considerations\n{{Item.Label}}: {{Item.Value}}\nFinancial Considerations\n{{Item.Label}}: {{Item.Value}}\nSize & Lot\n{{Item.Label}}: {{Item.Value}}\nUtilities\n{{Item.Label}}: {{Item.Value}}\nActivity\n{{Item.Label}}: {{Item.Value}}\nArea Map\nEstimated Monthly Mortgage Calculator\nThis calculator is provided by Burrow Services, Inc. for informational purposes. You should not make any decisions based simply on the information provided. Values indicated are estimates and may not be accurate and are only to be used as a guide. This calculator should not be relied upon in any way as the sole source of information. Please consult your financial, tax, or legal advisers for an accurate assessment of your mortgage payments and any advice relating to your personal circumstances.\nSimilar Listings\nSign up for a free account to view listing.\nOpen House\nPrice Reduced$20,000\nNew Listing\nPending\nComing Soon On\nVirtual Tour\nPENDING UNDER CONTRACT\nsold\nleased\n4273 WILLOW DRAW RD #604, Park City, UT 84098\n$3,379,000\nMLS# 2115961Condo/Townhouse\n2,667 Sq. Ft.\n4 BEDS4 BATHS\nListing Courtesy of Coldwell Banker Realty (Park City-Newpark)\nRequest Info\nDelete\nDetails\nSign up for a free account to view listing.\nOpen House\nPrice Reduced$20,000\nNew Listing\nPending\nComing Soon On\nVirtual Tour\nPENDING UNDER CONTRACT\nsold\nleased\n4273 Willow Draw Road #604, Park City, UT 84098\n$3,379,000\nMLS# 12504375Condo/Townhouse\n2,667 Sq. Ft.\n4 BEDS4 BATHS\nListing Courtesy of Coldwell Banker Realty (Park City-NewPark)\nRequest Info\nDelete\nDetails\nSign up for a free account to view listing.\nOpen House\nPrice Reduced\nNew Listing\nPending\nComing Soon On\nVirtual Tour\nPENDING UNDER CONTRACT\nsold\nleased\n1990 Stone Creek Road #19, Park City, UT 84098\n$3,125,000\nMLS# 12502572Condo/Townhouse\n2,317 Sq. Ft.\n3 BEDS4 BATHS\nListing Courtesy of KW Park City Keller Williams Real Estate | <PHONE_4>\nRequest Info\nDelete\nDetails\nSign up for a fre", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/52356910-314a-4d61-841d-dac37c71ef57", "content_hash": "4cedb2c5929fac4f45c204b05114b2716333049ae56c2bd4bf7958a9ae17ceb9", "created_at": "2026-03-28T05:11:11.358796978Z"}
{"id": "e4a44e5a-613c-44f4-8127-c6397e4d9bcb", "source": "brain", "text": "Taxonomy browser Taxonomy Browser (Jacqueshuberia loretensis)\n\nTaxonomy browser Taxonomy Browser (Jacqueshuberia loretensis)\nTry the New NCBI Taxonomy Pages!\nExplore our redesigned taxonomy browser and taxonomy record pages with faster, more intuitive search, taxonomy images, and links to NCBI Datasets and other data available at NCBI.\nEntrez PubMed Nucleotide Protein Genome Structure PMC Taxonomy BioCollections\nSearch for as complete name wild card token set taxonomy id lock\nEntrez records\nDatabase name Direct links Subtree links Links from type\nBioProject 1 1 -\nBioSample 1 1 -\nIdentical Protein Groups 2 2 -\nNucleotide 4 4 -\nProtein 2 2 -\nSRA 1 1 -\nTaxonomy 1 1 -\nJacqueshuberia loretensis\nTaxonomy ID: 321561 (for references in articles please use ncbitaxon:321561)\ncurrent name\nJacqueshuberia loretensis R.S.Cowan, 1985\nNCBI BLAST name: eudicots\nRank: species\nGenetic code: Translation table 1 (Standard)\nMitochondrial genetic code: Translation table 1 (Standard)\nLineage(full)\ncellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliopsida; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Caesalpinioideae; Tachigali clade; Jacqueshuberia\nComments and References:\nTROPICOS (Jul 07, 2017)\nName accessed on 7 July 2017 in: Tropicos.org. Missouri Botanical Garden, 2008 - 4344 Shaw Boulevard, Saint Louis, Missouri 63110, U.S.A. on line at: http://www.tropicos.org\nExternal Information Resources (NCBI LinkOut)\nLinkOut Subject LinkOut Provider\nJacqueshuberia loretensis Cowan taxonomy/phylogenetic Encyclopedia of life\nJacqueshuberia loretensis taxonomy/phylogenetic Plants of the World Online\nJacqueshuberia loretensis taxonomy/phylogenetic The International Plant Names Index\nsearch W3TROPICOS taxonomy/phylogenetic Vascular Tropicos\nWikipedia taxonomy/phylogenetic iPhylo\nNotes:\nGroups interested in participating in the LinkOut program should visit the LinkOut home page.\nA list of our current non-bibliographic LinkOut providers can be found here.\nDisclaimer: The NCBI taxonomy database is not an authoritative source for nomenclature or classification - please consult the relevant scientific literature for the most reliable information.\nReference: How to cite this resource - Schoch CL, et al. NCBI Taxonomy: a comprehensive update on curation, resources and tools. Database (Oxford). 2020: baaa062. PubMed: 32761142 PMC: PMC7408187.\nComments and questions to <EMAIL_19>\n[Help] [Search] [NLM NIH] [Disclaimer]", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/e4a44e5a-613c-44f4-8127-c6397e4d9bcb", "content_hash": "93aec33827c434026db63dedb46fdc799a4b4ebca240cc4eeda73ebfac6e4e5f", "created_at": "2026-03-28T05:11:11.330829991Z"}
{"id": "5e677b51-6c41-440b-b18b-ce3f7435494c", "source": "brain", "text": "Equivalent Circuit to Analyze the Transmitting Characteristics of a Cymbal Array | MDPI\n\nEquivalent Circuit to Analyze the Transmitting Characteristics of a Cymbal Array | MDPI\nSkip Content\nYou are currently on the new version of our website. Access the old version\nhere\n.\nClose\nJournals\nAll Journals\nJournal Finder\nProceedings Series\nPropose a Journal\nTopics\nBy Subjects\nBiology & Life Sciences\nBusiness & Economics\nChemistry & Materials\nComputer Science & Mathematics\nEngineering\nEnvironmental & Earth Sciences\nMedicine & Pharmacology\nPhysical Sciences\nPublic Health & Healthcare\nSocial Sciences, Arts & Humanities\nOur Topics\nAll Topics\nAbout Topics\nTopics Awards\nSubject Editors\nPropose a Topic\nAuthor Services\nInformation\nPublishing\nOpen Access Policy\nEditorial Process\nPublication Ethics\nSpecial Issues Guidelines\nArticle Processing Charge\nPublishing Services\nGuidelines\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nPartnerships\nSocieties\nConferences\nInstitutional Open\nAccess Program\nAbout\nCompany\nAbout Us\nMission\nImpact\nHistory\nLeadership\nOffice Locations\nAwards\nCareers\nProducts\nMedia\nNews\nBlog\nContact\nSupport\nSend Feedback\nSearch\nOpen mobile navigation\nHome\nJournals\nSensors\nVolume 22\nIssue 22\n10.3390/s22228743\nSensorsSensors\nOpen Cite\nCite\nOpen Share\nShare\nDownload PDF\nMore formats\nAbstractIntroductionEquivalent Circuit of a Cymbal ArrayValidation of the Equivalent Circuit AnalysisEfficiency of the Equivalent Circuit AnalysisConclusionsAuthor ContributionsFundingInstitutional Review Board StatementInformed Consent StatementData Availability StatementConflicts of InterestReferencesArticle Metrics\nArticle\n12 November 2022\nEquivalent Circuit to Analyze the Transmitting Characteristics of a Cymbal Array\nHayeong Shim1\n,\nKyungseop Kim2\n,\nHeeseon Seo2\nand\nYongrae Roh1,*\n1\nSchool of Mechanical Engineering, Kyungpook National University, Daegu 41566, Korea\n2\nAgency for Defense Development, Changwon 51678, Korea\n*\nAuthor to whom correspondence should be addressed.\nSensors2022, 22(22), 8743;https://doi.org/10.3390/s22228743\nThis article belongs to the Special Issue The Development of Piezoelectric Sensors and Actuators\nVersion Notes\nOrder Reprints\nAbstract\nA cymbal transducer has a simple structure consisting of a piezoceramic disk and metallic caps and has broadband characteristics when built as an array. The finite element method (FEM) is generally used to analyze the characteristics of acoustic transducers. However, the FEM requires a longer analysis time as the model becomes larger, which makes it limited and less efficient for analyzing the cymbal array. In this study, a new equivalent circuit with higher efficiency and accuracy, comparable to that of the FEM, was proposed to analyze the performance of cymbal arrays. The equivalent circuit for the array was constructed by connecting the equivalent circuits of individual cymbal transducers in parallel with a radiation impedance matrix that included both the self- and mutual radiation characteristics of the array. The validity of the new equivalent circuit was verified by measuring the transmitting voltage response of a cymbal array specimen and comparing it with that calculated using the circuit. The comparison confirmed the efficiency of the equivalent circuit in analyzing the characteristics of the cymbal array. The proposed equivalent circuit can facilitate the design of a large array of cymbal transducers.\nKeywords:\ncymbal transducer; equivalent circuit; broadband transducer; cymbal array\n1. Introduction\nA cymbal transducer is a miniaturized version of the class V flextensional transducer [1]. It consists of a piezoceramic disk and a pair of metal caps and has a low resonant frequency considering its small size. Broadband characteristics can be obtained when cymbals are arranged and used as an array [2].\nSince the development of the cymbal transducer by Newnham et al. in the 1990s, various studies have been conducted by many researchers [3,4,5,6,7,8]. The performance of cymbal transducers has generally been analyzed using the finite element method (FEM). However, an equivalent circuit for cymbal transducers has recently been developed [9,10]. However, in the case of the cymbal array, an equivalent circuit for exclusive use has not yet been developed, so the FEM or experimental analysis methods are still mainly used. For instance, Tressler et al. experimentally analyzed and compared the transmitting voltage response (TVR) of a cymbal array for different constituent materials and construction methods [11]. Zhang et al. analyzed the displacement of each element constituting a cymbal array and calculated the TVR while changing the spacing between the elements using the FEM [12]. Rajapan et al. fabricated cymbal array specimens with various encapsulation materials and measured their acoustic properties [13]. Du et al. analyzed the acoustic properties of a cymbal array using an experimental method [14]. Kim et al. derived an optimized array structure to maximize the bandwidth of a cymbal array using the FEM [15].\nThe analysis of the acoustic characteristics of the cymbal array as conducted in all these studies using the FEM or the experimental method is very time-consuming. The cymbal transducer is small compared to the wavelength at the resonant frequency. This small and curved geometry of the cymbal requires elaborate modeling and meshing, which prolongs the analysis time so much that using the FEM to analyze a cymbal array larger than a 3 \u00d7 3 array would hardly ever be feasible.\nThere are positive indications that the difficulty of analyzing the cymbal array using the FEM can be resolved by developing a dedicated equivalent circuit, as inspired by the study conducted by Pyo and Roh [16]. Several related studies have been conducted. As a case in point, Zhang et al. analyzed the cymbal array using the equivalent circuit method (ECM). However, the discrepancy between the measured and analyzed TVR spectra was not ignorable. This was attributed to the inaccuracy in the mutual radiation impedance between the cymbals in the array [17]. It is necessary to supplement the equivalent circuit by deriving an accurate radiation impedance matrix dedicated to the cymbal array.\nIn the case of cymbal arrays, the mutual radiation impedance has a significantly large impact on the acoustic characteristics of the array because a large number of transducers, smaller than the wavelength, are arranged within a narrow area [18]. A typical equivalent circuit does not reflect such mutual radiation impedance but considers only the self-radiation impedance of each transducer [19]. The mutual radiation impedance in an array has been studied in several studies using an equivalent circuit [20,21]. Oguz et al. analyzed the effect of mutual radiation impedance on each cell in a capacitive micromachined ultrasonic transducer array using an equivalent circuit [22]. Akhbari et al. developed equivalent circuits for arrays of curved and flat piezoelectric micromachined ultrasonic transducers and analyzed the radiation characteristics of arrays using the circuits [23]. Pyo and Roh designed a structure that maximized the bandwidth of a planar Tonpilz array using an equivalent circuit that included the mutual radiation impedance [16]. Sim et al. developed an equivalent circuit model that could predict the acoustic response of a cylindrical Tonpilz array by considering the mutual radiation impedance [24]. However, all these studies were related to arrays composed of transducers with a single radiating surface. Because the upper and lower caps of a cymbal transducer act as independent radiating surfaces, as noted in Zhang\u2019s work [17], the radiation impedance matrix used in previous studies is unsuitable for a cymbal array. The dual piston model in [17] was observed to be insufficient to express the interaction between elements in a cymbal array because the comparison between the measured and calculated results showed considerable differences.\nThis study proposes a new equivalent circuit that can accurately and efficiently resolve this", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/5e677b51-6c41-440b-b18b-ce3f7435494c", "content_hash": "3915b3afbcd06b8a84dd05466cbe8330669ba937fc468a32641a36f718623d50", "created_at": "2026-03-28T05:11:11.245822554Z"}
{"id": "a46b76bb-00d1-4dba-96c6-a43ff233c4eb", "source": "brain", "text": "Stage plantes sauvages comestibles du 01 au 02 Mai 2026 \u00e0 71110 Briant - Promonature\n\nStage plantes sauvages comestibles du 01 au 02 Mai 2026 \u00e0 71110 Briant - Promonature\nAller au contenu\nRechercher :\nRechercher\nRechercher\n0 \u20ac\nAccueil\nStages et formation\nBoutique\nNos activit\u00e9s\nFormation professionnelle\nBureau d\u2019\u00e9tudes botanique\nEdition Promonature\nDiagnostic de sols par les plantes bio-indicatrices\nActualit\u00e9\nPodcast\nPlantes et sant\u00e9\nLes m\u00e9dias en parlent\nNos partenaires\nContact\nRechercher :\nRechercher\nRechercher\n0 \u20ac\nAccueil\nStages et formation\nBoutique\nNos activit\u00e9s\nFormation professionnelle\nBureau d\u2019\u00e9tudes botanique\nEdition Promonature\nDiagnostic de sols par les plantes bio-indicatrices\nActualit\u00e9\nPodcast\nPlantes et sant\u00e9\nLes m\u00e9dias en parlent\nNos partenaires\nContact\nStage plantes sauvages comestibles du 01 au 02 Mai 2026 \u00e0 71110 Briant\nDate de l\u2019\u00e9v\u00e9nement :\n1 mai 2026\nHeure de l'\u00e9v\u00e9nement :\n9 h 00 min\nLieu de l'\u00e9v\u00e9nement :\nPromonature, Briant, 71110, France\nEvent Description\nDu 01 au 02 Mai 2026 \u00e0 Briant 71110\nPlantes sauvages comestibles\nAu c\u0153ur du Brionnais, accompagn\u00e9 de Delphine Suzor et G\u00e9rard Ducerf vous rencontrerez les plantes sauvages \u00e0 usages. Vous approfondirez vos connaissances afin de pratiquer des r\u00e9coltes \u00e9thiques, respectueuses et s\u00fbres puis vous les transformerez en une gastronomie simple et gourmande.\nDelphine Suzor & G\u00e9rard Ducerf vous guideront pour acqu\u00e9rir les bases n\u00e9cessaires \u00e0 une pratique autonome d\u2019identification, r\u00e9colter les bonnes esp\u00e8ces en toute confiance, les diff\u00e9rentes parties utilisables, dans le respect de l\u2019environnement et de la biodiversit\u00e9. Ils vous apprendront \u00e0 les identifier, savoir quand les r\u00e9colter et connaitre les modes de pr\u00e9paration.\nUn stage pour tout public sans pr\u00e9requis et pour les personnes souhaitant mieux comprendre et utiliser les plantes sauvages pr\u00e9sentes sur son jardin, ses parcelles, porteur de projet de tables d\u2019h\u00f4tes.\nLes stagiaires vont :\nSe familiariser avec les bases de la d\u00e9termination botanique et apprendre \u00e0 reconnaitre quelques esp\u00e8ces comestibles\nAcqu\u00e9rir les pr\u00e9alables \u00e0 des cueillettes en s\u00e9curit\u00e9 et respectueuses de l\u2019environnement\nD\u00e9couvrir les diff\u00e9rentes fa\u00e7ons de cuisiner les esp\u00e8ces sauvages comestibles\nApprendre \u00e0 int\u00e9grer dans son quotidien l\u2019utilisation des plantes sauvages\n\u27a1\ufe0f 2 jours de stage en cuisine / terrain : th\u00e9orie et mise en pratique\n\ufe0fRetrouvez le programme du stage en cliquant sur le lien ci-dessous:\nStage Plantes sauvages comestibles et cuisine 2 Jours \u2013 2026\nMerci de prendre connaissance des conditions g\u00e9n\u00e9rales de ventes et du r\u00e8glement int\u00e9rieur avant inscription \u00e0 une session de formation. Toute commande de formation aupr\u00e8s de la soci\u00e9t\u00e9 implique l\u2019acceptation sans r\u00e9serve du client des pr\u00e9sentes Conditions G\u00e9n\u00e9rales de Vente.\nConditions G\u00e9n\u00e9rales de Vente Formation\nR\u00e8glement int\u00e9rieur Formation\nInformations sur le stage\n\u200d Formateur: Delphine Suzor et G\u00e9rard Ducerf\n\ufe0f Lieu: Promonature \u2013 11 Impasse de la Goutte 71110 Briant\n\ufe0f Horaires: 9h00 \u2013 17h30 (pause de 1h30 pour la d\u00e9gustation des plats pr\u00e9par\u00e9s)\nCo\u00fbt de la formation:\nFinancement personnel : 192 \u20ac TTC \u27a1\ufe0f Possibilit\u00e9 de paiement en plusieurs fois sur demande. Merci de le mentionner dans le formulaire d\u2019inscription en bas de cette page.\nFinancement Viv\u00e9a : 350\u20ac TTC soit 25\u20ac/heure \u27a1\ufe0f Les personnes \u00e9ligibles doivent nous le signaler \u00e0 l\u2019aide du formulaire d\u2019inscription en bas de cette page.\nFinancement OPCO, FAF, Employeur : 280\u20ac TTC soit 20\u20ac/heure \u27a1\ufe0f Les personnes \u00e9ligibles doivent nous le signaler \u00e0 l\u2019aide du formulaire d\u2019inscription en bas de cette page.\nLes inscriptions sont obligatoires et doivent \u00eatre faites au plus tard avant le 26 Avril 2026.\nMat\u00e9riel \u00e0 pr\u00e9voir : V\u00eatements d\u2019ext\u00e9rieur en fonction de la m\u00e9t\u00e9o, chaussures de marche et de quoi prendre des notes, \u00e9ventuellement appareil photo. Si vous poss\u00e9dez une flore de terrain ainsi que des livres de recettes sur les plantes n\u2019h\u00e9sitez pas \u00e0 les apporter.\n\ufe0f H\u00e9bergement \u00e0 votre charge : Liste des h\u00e9bergements\n\ufe0f Repas compris le midi : D\u00e9gustation des pr\u00e9parations faites pendant le stage.\nTransport et acc\u00e8s : Plan\nLes stagiaires en situation d\u2019handicap sont invit\u00e9s \u00e0 prendre contact avec Promonature pour une \u00e9tude au cas par cas de leurs besoins. Nos formations avec pratique sur le terrain ne sont pas accessibles aux personnes en situation de certains handicap moteurs.\nNombre de stagiaire minimum pour le maintien de la formation : 8\nPour information :\nPROMONATURE est enregistr\u00e9e comme organisme de formation sous le num\u00e9ro 27710271071 et est certifi\u00e9 QUALIOPI depuis le 06/02/2024. Renseignez vous sur les possibilit\u00e9s de financement aupr\u00e8s de votre employeur, votre comit\u00e9 d\u2019entreprise, Viv\u00e9a (formation agricole pour adulte), France Travail ou la structure qui vous accompagne pour votre retour \u00e0 l\u2019emploi. Utilisez notre formulaire de demande de renseignement ci-dessous si besoin. Vous pouvez trouver votre OPCO ICI.\nTaux de satisfaction moyen 2024 93.75%\nFormulaire d\u2019inscription\nImportant : apr\u00e8s avoir soumis votre formulaire, vous devez recevoir un retour sur la page avec le message \u00ab Votre message a \u00e9t\u00e9 envoy\u00e9 \u00bb. Si ce n\u2019est pas le cas ou si vous ne recevez pas de confirmation d\u2019inscription dans les 48h, merci de contacter Magali au 06 99 21 65 74 ou <EMAIL_16>\n\u2190 Retour\nMerci pour votre r\u00e9ponse. \u2728\nNom et pr\u00e9nom(obligatoire)\nE-mail(obligatoire)\nT\u00e9l\u00e9phone(obligatoire)\nAdresse (obligatoire)\nDate de naissance (AAAA-MM-JJ)(obligatoire)\nFinancement envisag\u00e9(obligatoire)\nFinancement personnel Financement autre organisme (OPCO) Financement Viv\u00e9a Financement employeur Autre\nMessage et/ou pr\u00e9cision\nSp\u00e9cificit\u00e9s m\u00e9dicales / am\u00e9nagement sp\u00e9cifique handicap \u00e0 demander\nJ'ai pris connaissance des conditions g\u00e9n\u00e9rales de vente et je les accepte.(obligatoire)\nJ'ai pris connaissance du r\u00e8glement int\u00e9rieur et je l'accepte.(obligatoire)\nEnvoyer\n\u0394\nTicket Options\nAdulte\nStage 2 jours\n192,00\u20ac\nTotal Price : 0,00\u20ac\nRegister For This Event\nRegister For This Event\nTotal Seats\n10\nD\u00e9tails de l\u2019horaire de l\u2019\u00e9v\u00e9nement\n1 mai 2026 9 h 00 min-2 mai 2026 17 h 30 min\nLieu de l'\u00e9v\u00e9nement\nPromonature, Briant, 71110, France\nFind In Map\nLieu de l'\u00e9v\u00e9nement\nPartager cet l\u2019\u00e9v\u00e9nement\nAjouter un calendrier\nGoogle Yahoo Outlook Apple\nPanier\nPromonature au service de la nature depuis 1988 : Formations professionnelles, stages botaniques, inventaires floristiques et conseils des milieux cultiv\u00e9s et naturels avec la m\u00e9thode de Diagnostic de sol par les plantes bio-indicatrices, librairie des \u00e9ditions Promonature et autre.\n\u00a9 2026 Promonature et JFG Cr\u00e9ation\nX\nRetour en haut", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/a46b76bb-00d1-4dba-96c6-a43ff233c4eb", "content_hash": "86d7a63eb0dc3d0a59755354a8315c27f34af1a130192f1709f5ab3357067eab", "created_at": "2026-03-28T05:11:11.185786202Z"}
{"id": "4cffae1e-018a-435f-98b3-d0945ab76369", "source": "brain", "text": "Turkcell Esnaf 2 - Mevcut M\u00fc\u015fteri 24 Ay\n\nTurkcell Esnaf 2 - Mevcut M\u00fc\u015fteri 24 Ay\nBireysel\nKurumsal\nsuperonline.net\nPaketler\nYeni Turkcell'liler\nEsnaf ve K\u00fc\u00e7\u00fck \u0130\u015fletmeler\nOrta ve B\u00fcy\u00fck \u0130\u015fletmeler\nT\u00fcm Yeni Turkcell'liler\nMevcut Turkcell'liler\nEsnaf ve K\u00fc\u00e7\u00fck \u0130\u015fletmeler\nOrta ve B\u00fcy\u00fck \u0130\u015fletmeler\nEk Paketler\nYurtd\u0131\u015f\u0131nda Kullan\u0131m\nYurtd\u0131\u015f\u0131n\u0131 Arama\nT\u00fcm Mevcut Turkcell'liler\nMobil Wifi\nEsnaf ve K\u00fc\u00e7\u00fck \u0130\u015fletmeler\nOrta ve B\u00fcy\u00fck \u0130\u015fletmeler\nEk Paketler\nT\u00fcm Mobil Wifi\nSuperbox\nAna Paketler\nEk Paketler\nT\u00fcm Superbox\nM2M\nKampanyalar\nMobil\nMobil Wifi\nSuperbox\n\u0130\u015f Turkcell Plus\nT\u00fcm Kampanyalar\nTurkcell Platinum\nT\u00fcm Paketler\nDijital \u0130\u015e Servisleri\nKesintisiz Eri\u015fim\nYeni Nesil Veri Merkezi\nBulut (Cloud) \u00c7\u00f6z\u00fcmleri\nSiber G\u00fcvenlik\nY\u00f6netilen Hizmetler\nNesnelerin \u0130nterneti (IoT)\nB\u00fcy\u00fck Veri & Analitik\n\u0130\u015f Uygulamalar\u0131\ne-D\u00f6n\u00fc\u015f\u00fcm\nTurkcell E\u011fitim Y\u00f6netim Sistemi\nKurumsal Cihaz Kiralama\nMicrosoft 365\nAk\u0131ll\u0131 Faks\nMobil Santral\nT\u00fcm \u0130\u015f Uygulamalar\u0131\nYeni Nesil Teknolojiler\nSekt\u00f6rler\nFinans\nLojistik ve Ula\u015f\u0131m\nBelediyeler\nTurizm\nE\u011fitim\nSa\u011fl\u0131k\nPerakende\n\u00dcretim\nEnerji\nT\u00fcm Sekt\u00f6rler\nT\u00fcm Dijital \u0130\u015e Servisleri\n\u0130nternet & Telefon\nT\u00fcm \u0130nternet & Telefon\nCihazlar\nDonan\u0131m & Yaz\u0131l\u0131m \u00c7\u00f6z\u00fcmleri\nYeni Nesil Finansman \u00c7\u00f6z\u00fcmleri\nCihazlar\nCihaz Kiralama\nAk\u0131ll\u0131 Telefonlar\nTablet & Bilgisayar\nCihaz Kampanyalar\u0131\nT\u00fcm Cihazlar\nT\u00fcm Cihazlar\n\u0130\u015eTurkcell Plus\n\u015eirketinize \u00d6zel\n\u00c7al\u0131\u015fanlara \u00d6zel\nT\u00fcm \u0130\u015eTurkcell Plus\n\u0130\u015e Ortakl\u0131\u011f\u0131\nT\u00fcm \u0130\u015e Ortakl\u0131\u011f\u0131\nH\u0131zl\u0131 \u0130\u015flemler\n0\nPaketler\nDijital \u0130\u015e Servisleri\n\u0130nternet & Telefon\nCihazlar\n\u0130\u015eTurkcell Plus\n\u0130\u015e Ortakl\u0131\u011f\u0131\nH\u0131zl\u0131 \u0130\u015flemler\nGeri\nT\u00fcm\nBireyselKurumsal\nEsnaf 2 - Mevcut M\u00fc\u015fteri 24 Ay\n\u200bYeni hat alarak veya numaras\u0131n\u0131 ta\u015f\u0131yarak Turkcell'e gelen esnaflar 12 veya 24 ay taahh\u00fct verdiklerinde her y\u00f6ne bol dakika, bol internet ve SMS paketine \u00f6zel indirimlerle sahip oluyor, \u00fcstelik sabah 7 ak\u015fam 7 saatleri aras\u0131nda sabit y\u00f6nlere s\u0131n\u0131rs\u0131z dakikalarla esnaflar rahat rahat konu\u015fuyor, i\u015flerini kolayca tamaml\u0131yor, kafalar\u0131 rahat ediyor.\nEsnaf 2 - Mevcut M\u00fc\u015fteri 24 Ay\n\u200bYeni hat alarak veya numaras\u0131n\u0131 ta\u015f\u0131yarak Turkcell'e gelen esnaflar 12 veya 24 ay taahh\u00fct verdiklerinde her y\u00f6ne bol dakika, bol internet ve SMS paketine \u00f6zel indirimlerle sahip oluyor, \u00fcstelik sabah 7 ak\u015fam 7 saatleri aras\u0131nda sabit y\u00f6nlere s\u0131n\u0131rs\u0131z dakikalarla esnaflar rahat rahat konu\u015fuyor, i\u015flerini kolayca tamaml\u0131yor, kafalar\u0131 rahat ediyor.\nYILLIK ABONEL\u0130K\nBu paket abone al\u0131m\u0131na kapal\u0131d\u0131r, l\u00fctfen di\u011fer paketlerimizi inceleyiniz.\n41,77TL\nPaket Detaylar\u0131\nFaydalar\nDi\u011fer Sat\u0131n Alma Se\u00e7enekleri\nS\u0131k\u00e7a Sorulan Sorular\nDaha Fazla Bilgi\nHakk\u0131m\u0131zda\nDijital \u0130\u015f Servisleri\n\u0130\u015flem Merkezi\nKurumsal Destek\nT\u00fcketici \u015eikayetleri\nBizi Takip Edin\nDil Tercihi\nT\u00fcrk\u00e7e\nHakk\u0131m\u0131zda\nKurumsal \u0130leti\u015fim\n\u0130leti\u015fim\nM\u00fc\u015fteri Memnuniyeti Politikas\u0131\nGenel Bak\u0131\u015f\nTurkcell GSYF\nKurumsal \u0130leti\u015fim ve S\u00fcrd\u00fcr\u00fclebilirlik\nYat\u0131r\u0131mc\u0131 \u0130li\u015fkileri\nToptan\nAfet Tedbirleri\n\u0130\u015ftiraklerimiz ve Ba\u011fl\u0131 Ortakl\u0131klar\u0131m\u0131z\nT\u00fcm\u00fcn\u00fc\nG\u00f6r\nDijital \u0130\u015f Servisleri\nKalite Politikas\u0131\nKesintisiz Eri\u015fim\nYeni Nesil Veri Merkezi\nBulut (Cloud) \u00c7\u00f6z\u00fcmleri\nSiber G\u00fcvenlik\nY\u00f6netilen Hizmetler\nNesnelerin \u0130nterneti (IoT)\nB\u00fcy\u00fck Veri & Analitik\n\u0130\u015f Uygulamalar\u0131 ile e-D\u00f6n\u00fc\u015f\u00fcm\nYeni Nesil Teknolojiler\nT\u00fcm\u00fcn\u00fc\nG\u00f6r\n\u0130\u015flem Merkezi\nGiri\u015f Yap\nNumara Ta\u015f\u0131ma & Yeni Hat\nFatura Sorgula & \u00d6de\nTL & Paket Y\u00fckle\nSipari\u015f Takibi\nKurumsal Destek\nYurt D\u0131\u015f\u0131\nS\u0131k\u00e7a Sorulan Sorular - Fatural\u0131 Hat\nS\u0131k\u00e7a Sorulan Sorular - Haz\u0131r Kart\nT\u00fcketici \u015eikayetleri\n\u015eikayet Talebi Olu\u015fturma\n\u015eikayet Takibi\nAlacak Sorgulama, TL \u0130ade Talep\u200b\nBTK \u0130ade Duyurusu\nT\u00fcrk\u00e7e\nEnglish\n\u0627\u0644\u0639\u0631\u0628\u064a\u0629\n\u0440\u0443\u0441\u0441\u043a\u0438\u0439\nBizi Takip Edin\nFizy\nTurkcell Superonline\nPlatinum\nBiP\nTV+\nLifebox\nPaycell\nGame+\nGnctrkcll\nTurkcell Global Bilgi\nWiyo\nTurkcell Gelece\u011fi Yazanlar\nTurkcell Ak\u0131ll\u0131 Bulut\nGizlilik ve G\u00fcvenlik\n\u00a9 2026 Turkcell", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/4cffae1e-018a-435f-98b3-d0945ab76369", "content_hash": "c595ca67faf2d582d259c83805e9c71096d1ca98c462ef423b7c917ab3f3d953", "created_at": "2026-03-28T05:11:11.176314330Z"}
{"id": "93e77792-7a01-4f28-b560-b8a7b8aec071", "source": "brain", "text": "\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u76f4\u64ad_\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u8d5b\u7a0b_\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u5373\u65f6\u6bd4\u5206-\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\n\n\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u76f4\u64ad_\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u8d5b\u7a0b_\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u5373\u65f6\u6bd4\u5206-\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\nToggle navigation\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\n\u9996\u9875\n\u8db3\u7403\u76f4\u64ad\n\u7bee\u7403\u76f4\u64ad\n\u82f1\u8d85\u76f4\u64ad\n\u6b27\u51a0\u676f\u76f4\u64ad\n\u897f\u7532\u76f4\u64ad\n\u6fb3\u8d85\u76f4\u64ad\n\u5fb7\u7532\u76f4\u64ad\n\u6cd5\u7532\u76f4\u64ad\n\u4e2d\u8d85\u76f4\u64ad\n\u610f\u7532\u76f4\u64ad\n\u6b27\u8054\u76f4\u64ad\n\u6b27\u534f\u8054\u76f4\u64ad\n\u4e16\u6b27\u9884\u76f4\u64ad\n\u4e16\u4e9a\u9884\u76f4\u64ad\nNBA\u76f4\u64ad\nCBA\u76f4\u64ad\n\u8db3\u7403\u65b0\u95fb\n\u7bee\u7403\u65b0\u95fb\n\u8db3\u7403\u89c6\u9891\n\u7bee\u7403\u89c6\u9891\n\u9996\u9875\n\u7bee\u7403\u76f4\u64ad\n\u8db3\u7403\u76f4\u64ad\n\u8db3\u7403\u65b0\u95fb\n\u7bee\u7403\u65b0\u95fb\n\u8db3\u7403\u89c6\u9891\n\u7bee\u7403\u89c6\u9891\n\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b \u76f4\u64ad\n< >\n\u4eca\u65e5\u6cd5\u8bed\u56fd\u5bb6\u8fd0\u52a8\u4f1a\u8db3\u7403\u8d5b\u8d5b\u7a0b\u8868\n\u6682\u65e0\u8d44\u6599\n\u660e\u65e5\u672a\u5f00\u8d5b\u8d5b\u7a0b\u8868\n\u8db3\u7403\u65b0\u95fb\n\u5df4\u897f\u8fb9\u950b\u52a0\u5e03\u91cc\u57c3\u5c14\u91cd\u8fd4\u6d77\u6e2f\uff0c\u5415\u6587\u541b11\u53f7\u7403\u8863\u6709\u671b\u4f20\u627f\n\u82f1\u8d8524\u8f6e\uff0c\u5229\u7269\u6d664-1\u7ebd\u5361\u65af\u5c14\uff0c\u6770\u62c9\u5fb7\u79f0\u57c3\u57fa\u8482\u514b\u50cf\u6258\u96f7\u65af\n\u6b66\u6c49\u4e09\u9547\u5b98\u65b9\u5ba3\u5e03\uff1a\u5580\u9ea6\u9686\u56fd\u811a\u4e9a\u59c6\u5361\u59c6\u52a0\u76df\uff0c\u80fd\u5426\u52a9\u961f\u91cd\u8fd4\u4e2d\u8d85\u8363\u5149\uff1f\n\u6b27\u51a0\u5c0f\u7ec4\u8d5b\u7b2c8\u8f6e\u5b8c\u7ed3\uff0c12\u573a\u5927\u6218\u60ac\u5ff5\u8fed\u8d77\uff01\n\u57c3\u5229\u5965\u7279\u503a\u52a1\u8fd8\u6e05\uff0cAC\u7c73\u5170\u7ba1\u7406\u5c42\u4e0d\u52a8\u8361\uff0c\u672a\u6765\u51e0\u5929\u5b9a\u65b0\u8463\u4e8b\u4f1a\n\u70ed\u95e8\u8054\u8d5b\nNBA CBA \u82f1\u8d85 \u6b27\u51a0\u676f \u897f\u7532 \u6fb3\u8d85 \u5fb7\u7532 \u6cd5\u7532 \u4e2d\u8d85 \u610f\u7532 \u6b27\u8054 \u6b27\u534f\u8054 \u6c99\u7279\u8d85 \u7f8e\u804c\u8054 \u65e5\u8db3\u8054 \u97e9\u8db3\u8054 \u4e2d\u7532 \u58a8\u897f\u8d85 \u5df4\u897f\u7532 NBA\u590f\u5b63\u8054\u8d5b \u4e2d\u5973\u8d85 \u65e5\u672c\u5929\u7687\u676f \u4e16\u4ff1\u676f \u6b27\u8d85\u676f FIBA\u4e9a\u6d32\u676f \u7537\u7bee\u6b27\u6d32\u676f \u7403\u4f1a\u53cb\u8c0a \u82f1\u8054\u676f \u4e16\u5357\u7f8e\u9884 WNBA \u4e16\u6b27\u9884 \u4e16\u4e9a\u9884 \u82cf\u8d85 \u8db3\u534f\u676f\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\n\u5173\u4e8e\u6211\u4eec \u8054\u7cfb\u6211\u4eec\n\u7f51\u7ad9\u5730\u56fe Copyright \u00a9 \u7248\u6743\u6240\u6709 2025\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u6574\u5408\u8db3\u7403\u76f4\u64ad\u3001\u6b27\u51a0\u76f4\u64ad\u548c\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206\u7b49\u591a\u9879\u4f53\u80b2\u6570\u636e\uff0c\u4e3a\u7403\u8ff7\u63d0\u4f9b\u5168\u65b9\u4f4d\u7684\u8d5b\u4e8b\u4fe1\u606f\u5e73\u53f0\u3002 \u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u4ee5\u6b27\u51a0\u76f4\u64ad\u3001\u82f1\u8d85\u76f4\u64ad\u514d\u8d39\u76f4\u64ad\u89c6\u9891\u76f4\u64ad\u3001\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206\u7b49\u8d5b\u4e8b\u4e3a\u6838\u5fc3\u5185\u5bb9\uff0c\u63d0\u4f9b\u9ad8\u6e05\u8d5b\u4e8b\u76f4\u64ad\u3001\u4e13\u4e1a\u5206\u6790\u4e0e\u6743\u5a01\u62a5\u9053\uff0c\u8986\u76d6NBA\u3001\u6b27\u51a0\u3001\u82f1\u8d85\u76f4\u64ad\u7b49\u591a\u9879\u8d5b\u4e8b\u3002\u5e73\u53f0\u66f4\u65b0\u8fc5\u901f\u3001\u6570\u636e\u8be6\u5b9e\uff0c\u81f4\u529b\u4e8e\u4e3a\u7403\u8ff7\u6253\u9020\u5168\u9762\u3001\u6d41\u7545\u7684\u89c2\u8d5b\u4f53\u9a8c\uff0c\u8ba9\u4f53\u80b2\u7231\u597d\u8005\u968f\u65f6\u638c\u63e1\u6700\u65b0\u52a8\u6001\uff0c\u4eab\u53d7\u771f\u5b9e\u800c\u7cbe\u5f69\u7684\u4f53\u80b2\u4e16\u754c\u3002", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/93e77792-7a01-4f28-b560-b8a7b8aec071", "content_hash": "e02a7b55d1221c900840b560c716fb535b24ef5140b363a20c1df8c05005a860", "created_at": "2026-03-28T05:11:11.162985262Z"}
{"id": "9799bb96-f662-43a9-aa78-1e06a26de9e9", "source": "brain", "text": "tinted lip & cheek salve | i'm nature\n\ntinted lip & cheek salve | i'm nature\ntop of page\nHOME\nSHOP\nShop All\nCleanser\nToner-Serum\nMoisturizers\nSkincare Sets\nFace Massage Essentials\nLip Care\nDeodorant\nLimited Edition\nbe.come\nAccessories\nGift Card\nEvents\nWebinar\nBLOGS\nSkin Care Diary\nABOUT US\nAbout Us\nOur Philosophy\nOur Mission & DNA\nSustainability\nBBA Social Media\nFAQ\nTAKE A QUIZ\nShipping Policy\nReturn & Refund Policy\nPrivacy Policy\nTerms and Conditions\nContact Us\nSearch Results\nLoyalty\nMORE\nUse tab to navigate through the menu items.\nLog In\nSUBSCRIBE\nFOLLOW US\nStay up to date with all the latest information,\nproducts and discounts\nSUBSCRIBE\nThanks for submitting!\nCONTACT US\n8766 Wyngate Sunland California, 91040\n<EMAIL_17>\nMARKETING\n<EMAIL_18>\nABOUT US\nCUSTOMER SERVICE\n- About Us\n- Blogs\n- Contact Us\n- Testimonials\n- Privacy Policy\n- Terms & Conditions\n- Shipping Policy\n- Return Policy\nCopyright \u00a9 2025 bba organic LLC All Rights Reserved\nbottom of page", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/9799bb96-f662-43a9-aa78-1e06a26de9e9", "content_hash": "136d736aa5c68765c6fc66ada4c8285d56e434d04014ea7fb2e0187a23b60f42", "created_at": "2026-03-28T05:11:11.087370481Z"}
{"id": "fa383112-64f0-4601-aedd-1111a8278250", "source": "brain", "text": "TPA_inf: Coccidioides posadasii nat1 gene for arylamine N-acetyltransf - Nucleotide - NCBI\n\nTPA_inf: Coccidioides posadasii nat1 gene for arylamine N-acetyltransf - Nucleotide - NCBI\nWarning: The NCBI web site requires JavaScript to function. more...\nAn official website of the United States government\nHere's how you know\nThe .gov means it's official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard\nPublications\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nNucleotide\nSearch database All DatabasesAssemblyBiocollectionsBioProjectBioSampleBooksClinVarConserved DomainsdbGaPdbVarGeneGenomeGEO DataSetsGEO ProfilesGTRIdentical Protein GroupsMedGenMeSHNLM CatalogNucleotideOMIMPMCProteinProtein ClustersProtein Family ModelsPubChem BioAssayPubChem CompoundPubChem SubstancePubMedSNPSRAStructureTaxonomyToolKitToolKitAllToolKitBookgh\nSearch term\nSearch\nAdvanced\nHelp\nResult Filters\nGenBank\nFormat\nSummary\nGenBank\nGenBank (full)\nFASTA\nFASTA (text)\nGraphics\nASN.1\nRevision History\nAccession List\nGI List\nApply\nSend to:\nComplete Record\nCoding Sequences\nGene Features\nChoose Destination\nFile\nClipboard\nCollections\nAnalysis Tool\nFormat SummaryGenBankGenBank (full)FASTAASN.1XMLINSDSeq XMLTinySeq XMLFeature TableAccession ListGI ListGFF3\nShow GI\nCreate File\nAdd to Clipboard\nAdd to Collections\nChoose Sequence Analysis Tool\nBLAST\nPrimerBLAST\nSubmit\nDownload features.\nFormat FASTA NucleotideFASTA Protein\nCreate File\nDownload gene features.\nFormat FASTA Nucleotide\nCreate File\nTPA_inf: Coccidioides posadasii nat1 gene for arylamine N-acetyltransferase 1, strain RMSCC 2133, exons 1-2\nGenBank: BN001386.1\nFASTA Graphics\nno features Feature\nFirst\nPrevious\nNext\nLast\nDisplay: FASTA GenBank Help\nClose\nDetails\nSupplemental Content\nChange region shown\nWhole sequence\nSelected region\nfrom: to:\nUpdate View\nCustomize view\nBasic Features\nAll features\nGene, RNA, and CDS features only\nDisplay options\nShow sequence\nShow reverse complement\nShow gap features\nUpdate View\nAnalyze this sequence\nRun BLAST\nFind regions of similarity between this sequence and other sequences using BLAST.\nPick Primers\nDesign and test primers for this sequence using Primer-BLAST.\nHighlight Sequence Features\nOpens the Highlight Feature Bar and highlights feature annotations from the FEATURES table of the record. The Highlight Feature Bar can be used to navigate to and highlight other features and provides links to display the highlighted region separately. Links in the FEATURES table will also highlight the corresponding region of the sequence. More...\nFind in this Sequence\nFinds sub-sequences or patterns in the sequence and highlights the matching regions. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences. More...\nRelated information\nProtein\nProtein sequence from Nucleotide coding region\nPubMed\nPubMed articles cited by Nucleotide sequence record\nTaxonomy\nTaxonomy sequences associated with Nucleotide record\nPubMed (Weighted)\nLinks to pubmed\nRecent activity\nClear Turn Off Turn On\nTPA_inf: Coccidioides posadasii nat1 gene for arylamine N-acetyltransferase 1, s...\nTPA_inf: Coccidioides posadasii nat1 gene for arylamine N-acetyltransferase 1, strain RMSCC 2133, exons 1-2\ngi|300431512|tpe|BN001386.1|\nNucleotide\nYour browsing activity is empty.\nActivity recording is turned off.\nTurn recording back on\nSee more...\nClear\nFind\nFirst\nPrevious\nNext\nLast\nHelp\nClose\nFinds sub-sequence or patterns in the sequence and highlights the matching region. The tool works with standard single letter nucleotide or protein codes including ambiguities and can match Prosite patterns in protein sequences.\nMore...\nFollow NCBI\nTwitter\nFacebook\nLinkedIn\nGitHub\nNCBI Insights Blog\nConnect with NLM\nTwitter\nFacebook\nYoutube\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nHelp\nAccessibility\nCareers\nNLM\nNIH\nHHS\nUSA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fa383112-64f0-4601-aedd-1111a8278250", "content_hash": "2986138942490d6017d0f0372d5afc2c39fb61538519e10d8705e825fb67f551", "created_at": "2026-03-28T05:11:11.067152581Z"}
{"id": "f7a3ed2e-643e-4fa0-9ff3-706e17a2af52", "source": "brain", "text": "SPARCLE Architecture Viewer\n\nSPARCLE Architecture Viewer\nSkip to main page content\nU.S. National Library of Medicine\nNCBI National Center for Biotechnology Information\nMy NCBI Log in Log out\nAccesskeys\nSPARCLE >\nArchitecture Viewer\nPopular\nPubMed\nPMC\nPubMed Health\nBookshelf\nPubChem\nBLAST\nGene\nNucleotide\nProtein\nConnect\nFacebook\nTwitter\nLinkedIn\nYouTube\nGitHub\nNews RSS\nBlog\nContact\nSupport Center\nResources\nLiterature\nHealth\nGenomes\nGenes\nProteins\nChemicals\nActions\nSubmit\nDownload\nLearn\nDevelop\nAnalyze\nResearch\nNational Center for Biotechnology Information\n8600 Rockville Pike, Bethesda MD, 20894 USA\nDepartment of Health and Human Services National Institutes of Health National Library of Medicine USA.gov\nAbout NCBI Polices and Guidelines", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/f7a3ed2e-643e-4fa0-9ff3-706e17a2af52", "content_hash": "e7f155e2e7d5dc85c580ff3124a996b50ef7996f85f01c6a2e49a3d7379456b1", "created_at": "2026-03-28T05:11:11.063400101Z"}
{"id": "d1d0730a-b3df-490d-a0bb-5bdfccc4c4a5", "source": "brain", "text": "Frontiers | Analysis and Biophysics of Surface EMG for Physiotherapists and Kinesiologists: Toward a Common Language With Rehabilitation Engineers\n\nFrontiers | Analysis and Biophysics of Surface EMG for Physiotherapists and Kinesiologists: Toward a Common Language With Rehabilitation Engineers\nFrontiers in Neurology\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nSearch\nFrontiers in Neurology\nSections\nSections\nApplied Neuroimaging\nArtificial Intelligence in Neurology\nAutonomic Disorders\nCognitive and Behavioral Neurology\nDementia and Neurodegenerative Diseases\nDiagnostic Neuropathology\nEndovascular and Interventional Neurology\nEpilepsy\nExperimental Therapeutics\nHeadache and Neurogenic Pain\nMovement Disorders\nMultiple Sclerosis and Neuroimmunology\nNeuro-Oncology and Neurosurgical Oncology\nNeuro-Ophthalmology\nNeuro-Otology\nNeurocritical and Neurohospitalist Care\nNeuroepidemiology\nNeurogenetics\nNeuroinfectious Diseases\nNeurological Biomarkers\nNeuromuscular Disorders and Peripheral Neuropathies\nNeurorehabilitation\nNeurotechnology\nNeurotrauma\nPediatric Neurology\nSleep Disorders\nStroke\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nFrontiers in Neurology\nSections\nSections\nApplied Neuroimaging\nArtificial Intelligence in Neurology\nAutonomic Disorders\nCognitive and Behavioral Neurology\nDementia and Neurodegenerative Diseases\nDiagnostic Neuropathology\nEndovascular and Interventional Neurology\nEpilepsy\nExperimental Therapeutics\nHeadache and Neurogenic Pain\nMovement Disorders\nMultiple Sclerosis and Neuroimmunology\nNeuro-Oncology and Neurosurgical Oncology\nNeuro-Ophthalmology\nNeuro-Otology\nNeurocritical and Neurohospitalist Care\nNeuroepidemiology\nNeurogenetics\nNeuroinfectious Diseases\nNeurological Biomarkers\nNeuromuscular Disorders and Peripheral Neuropathies\nNeurorehabilitation\nNeurotechnology\nNeurotrauma\nPediatric Neurology\nSleep Disorders\nStroke\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nFrontiers in Neurology\nSections\nSections\nApplied Neuroimaging\nArtificial Intelligence in Neurology\nAutonomic Disorders\nCognitive and Behavioral Neurology\nDementia and Neurodegenerative Diseases\nDiagnostic Neuropathology\nEndovascular and Interventional Neurology\nEpilepsy\nExperimental Therapeutics\nHeadache and Neurogenic Pain\nMovement Disorders\nMultiple Sclerosis and Neuroimmunology\nNeuro-Oncology and Neurosurgical Oncology\nNeuro-Ophthalmology\nNeuro-Otology\nNeurocritical and Neurohospitalist Care\nNeuroepidemiology\nNeurogenetics\nNeuroinfectious Diseases\nNeurological Biomarkers\nNeuromuscular Disorders and Peripheral Neuropathies\nNeurorehabilitation\nNeurotechnology\nNeurotrauma\nPediatric Neurology\nSleep Disorders\nStroke\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nSubmit your researchSearch\nYour new experience awaits. Try the new design now and help us make it even better\nSwitch to the new experience\nMETHODS article\nFront. Neurol., 15 October 2020\nSec. Neurorehabilitation\nVolume 11 - 2020 | https://doi.org/10.3389/fneur.2020.576729\nThis article is part of the Research TopicSurface Electromyography: Barriers Limiting Widespread use of sEMG in Clinical Assessment and NeurorehabilitationView all 19 articles\nAnalysis and Biophysics of Surface EMG for Physiotherapists and Kinesiologists: Toward a Common Language With Rehabilitation Engineers\nLara McManus1* Giuseppe De Vito2 Madeleine M. Lowery1\n1Neuromuscular Systems Laboratory, School of Electrical and Electronic Engineering, University College Dublin, Dublin, Ireland\n2Neuromuscular Physiology Laboratory, Department of Biomedical Sciences, University of Padova, Padova, Italy\nRecent decades have seen a move toward evidence-based medicine to inform the clinical decision-making process with reproducible findings from high-quality research studies. There is a need for objective, quantitative measurement tools to increase the reliability and reproducibility of studies evaluating the efficacy of healthcare interventions, particularly in the field of physical and rehabilitative medicine. Surface electromyography (sEMG) is a non-invasive measure of muscle activity that is widely used in research but is under-utilized as a clinical tool in rehabilitative medicine. Other types of electrophysiological signals (e.g., electrocardiography, electroencephalography, intramuscular EMG) are commonly recorded by healthcare practitioners, however, sEMG has yet to successfully transition to clinical practice. Surface EMG has clear clinical potential as an indicator of muscle activation, however reliable extraction of information requires knowledge of the appropriate methods for recording and analyzing sEMG and an understanding of the underlying biophysics. These concepts are generally not covered in sufficient depth in the standard curriculum for physiotherapists and kinesiologists to encourage a confident use of sEMG in clinical practice. In addition, the common perception of sEMG as a specialized topic means that the clinical potential of sEMG and the pathways to application in practice are often not apparent. The aim of this paper is to address barriers to the translation of sEMG by emphasizing its benefits as an objective clinical tool and by overcoming its perceived complexity. The many useful clinical applications of sEMG are highlighted and examples provided to illustrate how it can be implemented in practice. The paper outlines how fundamental biophysics and EMG signal processing concepts could be presented to a non-technical audience. An accompanying tutorial with sample data and code is provided which could be used as a tool for teaching or self-guided learning. The importance of observing sEMG in routine use in clinic is identified as an essential part of the effective communication of sEMG recording and signal analysis methods. Highlighting the advantages of sEMG as a clinical tool and reducing its perceived complexity could bridge the gap between theoretical knowledge and practical application and provide the impetus for the widespread use of sEMG in clinic.\nIntroduction\nSurface EMG is currently an under-utilized clinical tool in rehabilitative medicine, despite its clear potential as a non-invasive measure of muscle activity. It is often considered more complex to analyze than intramuscular EMG, a technique commonly applied in clinical neurology, as parameters of direct clinical relevance cannot be readily extracted (", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/d1d0730a-b3df-490d-a0bb-5bdfccc4c4a5", "content_hash": "c9eab7e02005aba769b4bc8cb2609860d40746333bc291307f376cadda4f02f2", "created_at": "2026-03-28T05:11:10.982601660Z"}
{"id": "78f6392c-0094-4f4f-ad2b-4241729a3e71", "source": "brain", "text": "About Stress at Work | Stress | CDC\n\nAbout Stress at Work | Stress | CDC\nSkip directly to site content Skip directly to search\nAn official website of the United States government\nHere's how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.\nNational Institute for Occupational Safety and Health (NIOSH) Stress at Work\nExplore This Topic\nSearch\nSearch\nClear\nSearch\nFor Everyone\nStress and Work\nQuality of Worklife Questionnaire\nSuicide and Occupation\nTraumatic Incident Stress\nView all\nHome\nsearch\nclear\nsearch\nNational Institute for Occupational Safety and Health (NIOSH)\nStress\nMenu\nclear\nsearch\nFor Everyone\nStress and Work\nQuality of Worklife Questionnaire\nSuicide and Occupation\nTraumatic Incident Stress\nView All\nStress\nAbout Stress at Work\nFeb. 13, 2024\nLanguages\nEspa\u00f1ol\nEspa\u00f1ol (Puerto Rico)\nKey points\nJob stress happens when the requirements of a job do not match the capabilities, resources, or needs of the worker.\nJob stress can lead to poor health and even injury.\nOverview\nJob stress can be defined as the harmful physical and emotional responses that occur when the requirements of a job do not match the capabilities, resources, or needs of the worker. Job stress can lead to poor health and even injury.\nRelated NIOSH research\nUnderstanding the influence of what are commonly termed \"work organization\" or \"psychosocial\" factors on stress, illness, and injury.\nIdentifying ways to redesign jobs to create safer and healthier workplaces.\nRelated NIOSH activities\nDefining characteristics of healthy work organizations\nDeveloping work organization interventions to promote safe and healthy work conditions\nSurveilling the changing nature of work\nDesigning work schedule to protect the health and well-being of workers\nStudying the effects of new organizational policies and practices on worker health and safety\nExamining changing worker demographics (race/ethnicity, sex, and age) and worker safety and health\nInvestigating work organization, cardiovascular disease, and depression\nResearching psychological violence in the workplace\nPublishing educational documents on work, stress, and health\nJob stress and NORA\nOrganization of Work Team\nThe National Occupational Research Agenda (NORA), Organization of Work Team worked with partners to identify essential research and other requirements to better understand how work organization is changing, the safety and health implications of these changes, and prevention measures. The team developed the NIOSH report \"The Changing Organization of Work and the Safety and Health of Working People.\"\nHealthy Work Design and Well-Being Program\nThe NORA Healthy Work Design and Well-Being Program was developed to protect and advance worker safety, health, and well-being by improving the design of work, management practices, and the physical and psychosocial work environment. Job stress is identified as a priority area of the program.\nResources\nStress...At Work Booklet - DHHS (NIOSH) Publication No. 99 This booklet highlights knowledge about the causes of stress at work and outlines steps that can be taken to prevent job stress.\nWorker Health Chartbook 2004: Anxiety, Stress, and Neurotic Disorders - DHHS (NIOSH) Publication No. 2004-146 (2004) Provides data for anxiety and stress disorders based on magnitude and trend, age, sex race/ethnicity, severity, occupation, and industry.\nRelated NIOSH webpages\nAircraft Safety and Health - Job Stress\nCardiovascular Disease and Work\nNIOSH Quality of Worklife Questionnaire\nWork and Fatigue\nSearch the NIOSHTIC-2 search results on job stress to find additional occupational safety and health publications on this topic from NIOSH or a NIOSH-supported projects.\nVideos\nTranscript Low Resolution Video\nOn This Page\nOverview\nJob stress and NORA\nResources\nFeb. 13, 2024\nSources Print Share\nFacebook LinkedIn Twitter Syndicate\nContent Source:\nNational Institute for Occupational Safety and Health\nNIOSH\nThe Occupational Safety and Health Act of 1970 established NIOSH as a research agency focused on the study of worker safety and health, and empowering employers and workers to create safe and healthy workplaces.\nView All\nFor Everyone\nStress and Work\nQuality of Worklife Questionnaire\nSuicide and Occupation\nTraumatic Incident Stress\nSign up for Email Updates\nContact Us\nContact Us\nCall <PHONE_3>\nContact CDC\nAbout CDC\nAbout CDC\nPressroom\nOrganization\nBudget & Funding\nCareers & Jobs\nPolicies\nAccessibility\nExternal Links\nPrivacy\nWeb Policies\nFOIA\nOIG\nNo Fear Act\nNondiscrimination\nVulnerability Disclosure Policy\nLanguages\nLanguages\nEspa\u00f1ol\nLanguage Assistance\nEspa\u00f1ol\n\u7e41\u9ad4\u4e2d\u6587\nTi\u1ebfng Vi\u1ec7t\n\ud55c\uad6d\uc5b4\nTagalog\n\u0420\u0443\u0441\u0441\u043a\u0438\u0439\n\u0627\u0644\u0639\u0631\u0628\u064a\u0629\nKrey\u00f2l Ayisyen\nFran\u00e7ais\nPolski\nPortugu\u00eas\nItaliano\nDeutsch\n\u65e5\u672c\u8a9e\n\u0641\u0627\u0631\u0633\u06cc\nEnglish\nArchive\nCDC Archive\nPublic Health Publications\nContact Us\nContact Us\nCall <PHONE_3>\nContact CDC\nAbout CDC\nPressroom\nOrganization\nBudget & Funding\nCareers & Jobs\nAbout CDC\nPolicies\nAccessibility\nExternal Links\nPrivacy\nWeb Policies\nFOIA\nOIG\nNo Fear Act\nNondiscrimination\nVulnerability Disclosure Policy\nLanguages\nLanguages\nEspa\u00f1ol\nLanguage Assistance\nEspa\u00f1ol\n\u7e41\u9ad4\u4e2d\u6587\nTi\u1ebfng Vi\u1ec7t\n\ud55c\uad6d\uc5b4\nTagalog\n\u0420\u0443\u0441\u0441\u043a\u0438\u0439\n\u0627\u0644\u0639\u0631\u0628\u064a\u0629\nKrey\u00f2l Ayisyen\nFran\u00e7ais\nPolski\nPortugu\u00eas\nItaliano\nDeutsch\n\u65e5\u672c\u8a9e\n\u0641\u0627\u0631\u0633\u06cc\nEnglish\nArchive\nCDC Archive\nPublic Health Publications\nHHS.gov USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/78f6392c-0094-4f4f-ad2b-4241729a3e71", "content_hash": "60bd920d6eeab29395237c0cccc5513c2c6eb6f80edb8875f1553c5d224fc1e1", "created_at": "2026-03-28T05:11:10.910390924Z"}
{"id": "98445ece-411f-4542-9d43-16c4308a73e2", "source": "brain", "text": "3FFN: Crystal structure of calcium-free human gelsolin\n\n3FFN: Crystal structure of calcium-free human gelsolin\nNCBI\nNational Center for\nBiotechnology Information\nSearch\n3FFN: Crystal structure of calcium-free human gelsolin\nPDB ID: 3FFNDownload\nMMDB ID: 77149\nPDB Deposition Date: 2008/12/4\nUpdated in MMDB: 2017/11\nExperimental Method:\nx-ray diffraction\nResolution: 3 \u00c5\nSource Organism:\nHomo sapiens\nSimilar Structures:\nVAST+\nDownload sequence data\nMolecular Components in 3FFN\nLabel\nCount\nMolecule\nProteins (2 molecules)\nA\nB\n2\nGelsolin\n(Gene symbol: GSN)\n* Click molecule labels to explore molecular sequence information.\nCiting MMDB\nMadej T, Lanczycki CJ, Zhang D, Thiessen PA, Geer RC, Marchler-Bauer A, Bryant SH. \" MMDB and VAST+: tracking structural similarities between macromolecular complexes. Nucleic Acids Res. 2014 Jan; 42(Database issue):D297-303", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/98445ece-411f-4542-9d43-16c4308a73e2", "content_hash": "681d01d6b00a8a8875014615ff5e6d050f207ae8e9fd6b3621309dd265fb3682", "created_at": "2026-03-28T05:11:10.824798508Z"}
{"id": "7a30ac0c-de51-4b5d-b0a0-1d1bbc67b5f5", "source": "brain", "text": "tf.raw_ops.ConjugateTranspose | TensorFlow v2.5.0\n\ntf.raw_ops.ConjugateTranspose | TensorFlow v2.5.0\nSkip to main content\nInstall Learn\nIntroduction\nNew to TensorFlow?\nTutorials\nLearn how to use TensorFlow with end-to-end examples\nGuide\nLearn framework concepts and components\nLearn ML\nEducational resources to master your path with TensorFlow\nAPI\nTensorFlow (v2.16.1)\nVersions\u2026\nTensorFlow.js\nTensorFlow Lite\nTFX\nEcosystem\nLIBRARIES\nTensorFlow.js\nDevelop web ML applications in JavaScript\nTensorFlow Lite\nDeploy ML on mobile, microcontrollers and other edge devices\nTFX\nBuild production ML pipelines\nAll libraries\nCreate advanced models and extend TensorFlow\nRESOURCES\nModels & datasets\nPre-trained models and datasets built by Google and the community\nTools\nTools to support and accelerate TensorFlow workflows\nResponsible AI\nResources for every stage of the ML workflow\nRecommendation systems\nBuild recommendation systems with open source tools\nCommunity\nGroups\nUser groups, interest groups and mailing lists\nContribute\nGuide for contributing to code and documentation\nBlog\nStay up to date with all things TensorFlow\nForum\nDiscussion platform for the TensorFlow community\nWhy TensorFlow\nAbout\nCase studies\n/\nEnglish\n\u4e2d\u6587 \u2013 \u7b80\u4f53\nGitHub Sign in\nTensorFlow v2.5.0\nOverview Python C++ Java\nInstall\nLearn\nMore\nAPI\nMore\nOverview\nPython\nC++\nJava\nEcosystem\nMore\nCommunity\nMore\nWhy TensorFlow\nMore\nGitHub\nOverview\nAll Symbols\nPython v2.5.0\ntf\nOverview\nAggregationMethod\nCriticalSection\nDeviceSpec\nGradientTape\nGraph\nIndexedSlices\nIndexedSlicesSpec\nModule\nOperation\nOptionalSpec\nRaggedTensor\nRaggedTensorSpec\nRegisterGradient\nSparseTensorSpec\nTensor\nTensorArray\nTensorArraySpec\nTensorShape\nTensorSpec\nTypeSpec\nUnconnectedGradients\nVariable\nVariable.SaveSliceInfo\nVariableAggregation\nVariableSynchronization\nargsort\nbatch_to_space\nbitcast\nboolean_mask\nbroadcast_dynamic_shape\nbroadcast_static_shape\nbroadcast_to\ncase\ncast\nclip_by_global_norm\nclip_by_norm\nclip_by_value\nconcat\ncond\nconstant\nconstant_initializer\ncontrol_dependencies\nconvert_to_tensor\ncustom_gradient\ndevice\ndynamic_partition\ndynamic_stitch\nedit_distance\neinsum\nensure_shape\nexecuting_eagerly\nexpand_dims\nextract_volume_patches\neye\nfill\nfingerprint\nfoldl\nfoldr\nfunction\ngather\ngather_nd\nget_logger\nget_static_value\ngrad_pass_through\ngradients\ngroup\nguarantee_const\nhessians\nhistogram_fixed_width\nhistogram_fixed_width_bins\nidentity\nidentity_n\ninit_scope\ninside_function\nis_tensor\nlinspace\nload_library\nload_op_library\nmake_ndarray\nmake_tensor_proto\nmap_fn\nmeshgrid\nname_scope\nno_gradient\nno_op\nnondifferentiable_batch_function\nnorm\nnumpy_function\none_hot\nones\nones_initializer\nones_like\npad\nparallel_stack\nprint\npy_function\nquantize_and_dequantize_v4\nrandom_normal_initializer\nrandom_uniform_initializer\nrange\nrank\nrealdiv\nrecompute_grad\nregister_tensor_conversion_function\nrepeat\nrequired_space_to_batch_paddings\nreshape\nreverse\nreverse_sequence\nroll\nscan\nscatter_nd\nsearchsorted\nsequence_mask\nshape\nshape_n\nsize\nslice\nsort\nspace_to_batch\nspace_to_batch_nd\nsplit\nsqueeze\nstack\nstop_gradient\nstrided_slice\nswitch_case\ntensor_scatter_nd_add\ntensor_scatter_nd_max\ntensor_scatter_nd_min\ntensor_scatter_nd_sub\ntensor_scatter_nd_update\ntensordot\ntile\ntimestamp\ntranspose\ntruncatediv\ntruncatemod\ntuple\ntype_spec_from_value\nunique\nunique_with_counts\nunravel_index\nunstack\nvariable_creator_scope\nvectorized_map\nwhere\nwhile_loop\nzeros\nzeros_initializer\nzeros_like\ntf.audio\nOverview\ndecode_wav\nencode_wav\ntf.autodiff\nOverview\nForwardAccumulator\ntf.autograph\nOverview\nset_verbosity\nto_code\nto_graph\ntrace\nexperimental\nOverview\nFeature\ndo_not_convert\nset_loop_options\ntf.bitwise\nOverview\nbitwise_and\nbitwise_or\nbitwise_xor\ninvert\nleft_shift\nright_shift\ntf.compat\nOverview\nas_bytes\nas_str\nas_str_any\nas_text\ndimension_at_index\ndimension_value\nforward_compatibility_horizon\nforward_compatible\npath_to_str\nv1\nOverview\nAttrValue\nAttrValue.ListValue\nConditionalAccumulator\nConditionalAccumulatorBase\nConfigProto\nConfigProto.DeviceCountEntry\nConfigProto.Experimental\nDeviceSpec\nDimension\nEvent\nFixedLengthRecordReader\nGPUOptions\nGPUOptions.Experimental\nGPUOptions.Experimental.VirtualDevices\nGraphDef\nGraphKeys\nGraphOptions\nHistogramProto\nIdentityReader\nInteractiveSession\nLMDBReader\nLogMessage\nMetaGraphDef\nMetaGraphDef.CollectionDefEntry\nMetaGraphDef.MetaInfoDef\nMetaGraphDef.MetaInfoDef.FunctionAliasesEntry\nMetaGraphDef.SignatureDefEntry\nNameAttrList\nNameAttrList.AttrEntry\nNodeDef\nNodeDef.AttrEntry\nNodeDef.ExperimentalDebugInfo\nOptimizerOptions\nPrint\nReaderBase\nRunMetadata\nRunMetadata.FunctionGraphs\nRunOptions\nRunOptions.Experimental\nRunOptions.Experimental.RunHandlerPoolOptions\nSession\nSessionLog\nSparseConditionalAccumulator\nSparseTensorValue\nSummary\nSummary.Audio\nSummary.Image\nSummary.Value\nSummaryMetadata\nSummaryMetadata.PluginData\nTFRecordReader\nTensorInfo\nTensorInfo.CompositeTensor\nTensorInfo.CooSparse\nTextLineReader\nVariable\nVariableAggregation\nVariableScope\nWholeFileReader\nadd_check_numerics_ops\nadd_to_collection\nadd_to_collections\nall_variables\narg_max\narg_min\nargmax\nargmin\nassert_equal\nassert_greater\nassert_greater_equal\nassert_integer\nassert_less\nassert_less_equal\nassert_near\nassert_negative\nassert_non_negative\nassert_non_positive\nassert_none_equal\nassert_positive\nassert_rank\nassert_rank_at_least\nassert_rank_in\nassert_scalar\nassert_type\nassert_variables_initialized\nassign\nassign_add\nassign_sub\nbatch_gather\nbatch_scatter_update\nbatch_to_space\nbatch_to_space_nd\nbincount\nboolean_mask\ncase\nclip_by_average_norm\ncolocate_with\ncond\nconfusion_matrix\nconstant\ncontainer\ncontrol_flow_v2_enabled\nconvert_to_tensor\nconvert_to_tensor_or_indexed_slices\nconvert_to_tensor_or_sparse_tensor\ncount_nonzero\ncount_up_to\ncreate_partitioned_variables\ndecode_csv\ndecode_raw\ndelete_session_tensor\ndepth_to_space\ndevice\ndisable_control_flow_v2\ndisable_eager_execution\ndisable_resource_variables\ndisable_tensor_equality\ndisable_v2_behavior\ndisable_v2_tensorshape\nenable_control_flow_v2\nenable_eager_execution\nenable_resource_variables\nenable_tensor_equality\nenable_v2_behavior\nenable_v2_tensorshape\nexecuting_eagerly\nexecuting_eagerly_outside_functions\nexpand_dims\nextract_image_patches\nfixed_size_partitioner\nfloor_div\nfoldl\nfoldr\ngather\ngather_nd\nget_collection\nget_collection_ref\nget_default_graph\nget_default_session\nget_local_variable\nget_seed\nget_session_handle\nget_session_tensor\nget_variable\nget_variable_scope\nglobal_variables\nglobal_variables_initializer\ngradients\nhessians\ninitialize_all_tables\ninitialize_all_variables\ninitialize_local_variables\ninitialize_variables\nis_variable_initialized\nload_file_system_library\nlocal_variables\nlocal_variables_initializer\nmake_template\nmap_fn\nmin_max_variable_partitioner\nmodel_variables\nmoving_average_variables\nmultinomial\nno_regularizer\nnorm\nones_like\nop_scope\npad\nparse_example\nparse_single_example\nplaceholder\nplaceholder_with_default\npy_func\nquantize_v2\nrandom_normal_initializer\nrandom_poisson\nrandom_uniform_initializer\nreduce_all\nreduce_any\nreduce_join\nreduce_logsumexp\nreduce_max\nreduce_mean\nreduce_min\nreduce_prod\nreduce_sum\nreport_uninitialized_variables\nreset_default_graph\nresource_variables_enabled\nreverse_sequence\nscalar_mul\nscan\nscatter_add\nscatter_div\nscatter_max\nscatter_min\nscatter_mul\nscatter_nd_add\nscatter_nd_sub\nscatter_nd_update\nscatter_sub\nscatter_update\nserialize_many_sparse\nserialize_sparse\nset_random_seed\nsetdiff1d\nshape\nsize\nspace_to_batch\nspace_to_depth\nsparse_add\nsparse_concat\nsparse_matmul\nsparse_merge\nsparse_placeholder\nsparse_reduce_max\nsparse_reduce_max_sparse\nsparse_reduce_sum\nsparse_reduce_sum_sparse\nsparse_segment_mean\nsparse_segment_sqrt_n\nsparse_segment_sum\nsparse_split\nsparse_to_dense\nsqueeze\nstring_split\nstring_to_hash_bucket\nstring_to_number\nsubstr\ntables_initializer\nto_bfloat16\nto_complex128\nto_complex64\nto_double\nto_float\nto_int32\nto_int64\ntrainable_variables\ntranspose\ntruncated_normal_initializer\ntuple\nuniform_unit_scaling_initializer\nvariable_axis_size_partitioner\nvariable_creator_scope\nvariable_op_scope\nvariable_scope\nvariables_initializer\nverify_tensor_all_finite\nwhere\nwhile_loop\nwrap_functi", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/7a30ac0c-de51-4b5d-b0a0-1d1bbc67b5f5", "content_hash": "f17ac7e0bd33b315dc00bfdc5507ad989cc831f4bf5ec53d0e277be195a99e5e", "created_at": "2026-03-28T05:11:10.769263139Z"}
{"id": "38224a8f-3fd0-4a68-9c39-d02992904a7d", "source": "brain", "text": "Tomar medicamentos para tratar la tuberculosis: MedlinePlus enciclopedia m\u00e9dica\n\nTomar medicamentos para tratar la tuberculosis: MedlinePlus enciclopedia m\u00e9dica\nOmita y vaya al Contenido\nUn sitio oficial del Gobierno de Estados Unidos\nAs\u00ed es como usted puede verificarlo\nAs\u00ed es como usted puede verificarlo\nLos sitios web oficiales usan .gov\nUn sitio web .gov pertenece a una organizaci\u00f3n oficial del Gobierno de Estados Unidos.\nLos sitios web seguros .gov usan HTTPS\nUn candado ( Lock\nLocked padlock icon ) o https:// significa que usted se conect\u00f3 de forma segura a un sitio web .gov. Comparta informaci\u00f3n sensible s\u00f3lo en sitios web oficiales y seguros.\nBiblioteca Nacional de Medicina\nMen\u00fa\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nAcerca de MedlinePlus\nB\u00fasqueda\nBusque en MedlinePlus\nBUSCAR\nAcerca de MedlinePlus\nQu\u00e9 hay de nuevo\n\u00cdndice\nCont\u00e1ctenos\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nEnglish\nUsted est\u00e1 aqu\u00ed:\nP\u00e1gina Principal \u2192\nEnciclopedia m\u00e9dica \u2192\nTomar medicamentos para tratar la tuberculosis\nDirecci\u00f3n de esta p\u00e1gina: //medlineplus.gov/spanish/ency/patientinstructions/000425.htm\nTomar medicamentos para tratar la tuberculosis\nPara usar las funciones de compartir de esta p\u00e1ginas, por favor, habilite JavaScript.\nLa tuberculosis (TB) es una infecci\u00f3n bacterial contagiosa que compromete principalmente los pulmones, pero puede propagarse a otros \u00f3rganos. El objetivo del tratamiento es curar la infecci\u00f3n con medicamentos que combatan a la bacteria de la TB.\n\u00bfPor qu\u00e9 necesita medicamentos para la tuberculosis?\nUsted puede tener una infecci\u00f3n de TB pero no la enfermedad activa o los s\u00edntomas. Esto significa que la bacteria de esta enfermedad permanece inactiva (latente) en una zona peque\u00f1a de sus pulmones. Este tipo de infecci\u00f3n puede estar presente durante a\u00f1os y se llama tuberculosis latente. Con la TB latente:\nUsted no puede propagar la enfermedad a otras personas.\nEn algunas personas, la bacteria puede volverse activa. Si esto sucede, usted puede resultar enfermo o puede pasarle los g\u00e9rmenes de la TB a otra persona.\nAunque usted no se sienta enfermo, necesitar\u00e1 tomar medicamentos para la tuberculosis durante 6 a 9 meses. Esta es la \u00fanica manera de garantizar que se destruyan todas las bacterias de la TB en su cuerpo y no desarrolle una infecci\u00f3n activa en el futuro.\nCuando usted tiene tuberculosis activa, puede sentirse enfermo o tener tos, bajar de peso, sentirse cansado o tener fiebre o sudores fr\u00edos. Con la TB activa:\nUsted puede transmitir la tuberculosis a otras personas en su entorno. Esto incluye a las personas con quienes usted vive, trabaja o con quienes tiene un estrecho contacto.\nUsted necesita tomar varios medicamentos para la tuberculosis durante al menos 6 meses para eliminar de su cuerpo las bacterias de esta enfermedad. Debe empezar a sentirse mejor al cabo de un mes de haber comenzado los medicamentos.\nDurante las primeras 2 a 4 semanas despu\u00e9s de empezar a tomar los medicamentos, posiblemente deba permanecer en casa para evitar la propagaci\u00f3n de la tuberculosis a otros. Preg\u00fantele a su proveedor de atenci\u00f3n m\u00e9dica cu\u00e1ndo puede estar cerca de otras personas sin problema.\nSu proveedor est\u00e1 obligado por ley a informar sobre su caso a la Secretar\u00eda de Salud P\u00fablica local.\nSe le puede obligar legalmente a tomar sus medicamentos.\nPreg\u00fantele a su proveedor si otras personas con quienes usted trabaja o vive deben ser examinadas en busca de tuberculosis.\nC\u00f3mo tomar los medicamentos\nLos g\u00e9rmenes de la tuberculosis mueren muy lentamente. Usted necesita tomar varias p\u00edldoras diferentes en distintos momentos del d\u00eda, durante 6 meses o m\u00e1s. La \u00fanica forma de eliminarlos es tomar los medicamentos para la tuberculosis de la manera como su proveedor lo haya indicado. Esto significa tomar todos los medicamentos todos los d\u00edas.\nSi no toma sus medicamentos para la tuberculosis de la manera correcta o deja de tomarlas antes:\nSu infecci\u00f3n de tuberculosis puede empeorar.\nSu infecci\u00f3n puede resultar m\u00e1s dif\u00edcil de tratar. Los medicamentos que est\u00e9 tomando pueden dejar de hacer efecto. Esto se denomina tuberculosis farmacorresistente y puede ser muy dif\u00edcil de tratar.\nTal vez necesite tomar otros medicamentos con m\u00e1s efectos secundarios y menos capacidad para curar la infecci\u00f3n.\nLe puede propagar la infecci\u00f3n a otros.\nSi a su proveedor le preocupa que usted tal vez no est\u00e9 tomando todos los medicamentos de acuerdo con las instrucciones, puede ordenar que alguien lo visite todos los d\u00edas o unas cuantas veces a la semana para vigilar que usted tome los medicamentos para la tuberculosis. Esto se llama tratamiento de observaci\u00f3n directa.\nEfectos secundarios y otros problemas\nLas mujeres que puedan estar embarazadas, que est\u00e9n embarazadas o que est\u00e9n amamantando deben hablar con su proveedor antes de tomar estos medicamentos. Si est\u00e1 utilizando pastillas anticonceptivas, preg\u00fantele a su proveedor si los medicamentos para la tuberculosis pueden hacer que las p\u00edldoras anticonceptivas sean menos efectivas.\nLa mayor\u00eda de las personas no tiene efectos secundarios muy graves a ra\u00edz de los medicamentos para la tuberculosis. Los problemas con los que hay que tener cuidado y comentarle a su proveedor incluyen:\nArticulaciones dolorosas\nHematomas o tendencia al sangrado\nFiebre\nPoco o ning\u00fan apetito\nHormigueo o dolores en los dedos de los pies o las manos, o alrededor de la boca\nMalestar estomacal, n\u00e1useas o v\u00f3mitos y c\u00f3licos o dolor de estomago\nProblemas de la visi\u00f3n\nPiel u ojos amarillos (ictericia)\nOrina de color del t\u00e9 o naranja (la orina de color naranja es normal con algunos medicamentos)\nCu\u00e1ndo llamar al m\u00e9dico\nComun\u00edquese con su proveedor si tiene:\nCualquiera de los efectos secundarios mencionados anteriormente\nNuevos s\u00edntomas de TB activa, como tos, fiebre o sudores nocturnos, dificultad para respirar, o dolor en el pecho\nNombres alternativos\nMedicamentos - tuberculosis; TVD; Terapia vigilada directamente; TB - medicamentos\nReferencias\nBailey TC, Philips JA. Tuberculosis. In: Goldman L, Cooney KA, eds. Goldman-Cecil Medicine. 27th ed. Philadelphia, PA: Elsevier; 2024:chap 299.\nHorne DJ, Payam N. Tuberculosis: treatment of drug-susceptible and drug-resistant. In: Broaddus VC, King TE, Ernst JD, et al, eds. Murray and Nadel's Textbook of Respiratory Medicine. 7th ed. Philadelphia, PA: Elsevier; 2022:chap 54.\nUltima revisi\u00f3n 11/25/2023\nVersi\u00f3n en ingl\u00e9s revisada por: Denis Hadjiliadis, MD, MHS, Paul F. Harron Jr. Professor of Medicine, Pulmonary, Allergy, and Critical Care, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA. Also reviewed by David C. Dugdale, MD, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A.M. Editorial team.\nTraducci\u00f3n y localizaci\u00f3n realizada por: DrTango, Inc.\nConozca c\u00f3mo citar esta p\u00e1gina\nTemas de salud relacionados\nTuberculosis\nHojee la enciclopedia\nHealth Content Provider\n06/01/2028\nA.D.A.M., Inc. est\u00e1 acreditada por la URAC, tambi\u00e9n conocido como American Accreditation HealthCare Commission (www.urac.org). La acreditaci\u00f3n de la URAC es un comit\u00e9 auditor independiente para verificar que A.D.A.M. cumple los rigurosos est\u00e1ndares de calidad e integridad. A.D.A.M. es una de las primeras empresas en alcanzar esta tan importante distinci\u00f3n en servicios de salud en la red. Conozca m\u00e1s sobre la politica editorial, el proceso editorial, y la poliza de privacidad de A.D.A.M.\nLa informaci\u00f3n aqu\u00ed proporcionada no debe utilizarse durante ninguna emergencia m\u00e9dica ni para el diagn\u00f3stico o tratamiento de ninguna afecci\u00f3n m\u00e9dica. Se debe consultar a un profesional m\u00e9dico autorizado para el diagn\u00f3stico y tratamiento de cualquiera y todas las afecciones m\u00e9dicas. Los enlaces a otros sitios se proporcionan \u00fanicamente con fines informativos; no constituyen una recomendaci\u00f3n de dichos sitios. No se ofrece garant\u00eda alguna, expresa ni impl\u00edcita, en cuanto a la precisi\u00f3n, fiabilidad, puntualidad o exactitud de las traducciones realizadas por un servicio externo de la informaci\u00f3n aqu\u00ed proporcionada a cualquier otro idioma.\n", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/38224a8f-3fd0-4a68-9c39-d02992904a7d", "content_hash": "0fb16078836948bd49001df26bf7bbb55c0421b32eba6a5ea6118f1861384abf", "created_at": "2026-03-28T05:11:10.723323722Z"}
{"id": "0cbef759-4fa7-4c27-926d-0af604296eda", "source": "brain", "text": "Exploiting High Geopositioning Accuracy of SAR Data to Obtain Accurate Geometric Orientation of Optical Satellite Images\n\nExploiting High Geopositioning Accuracy of SAR Data to Obtain Accurate Geometric Orientation of Optical Satellite Images\nNext Article in Journal\nA Comparison of ALS and Dense Photogrammetric Point Clouds for Individual Tree Detection in Radiata Pine Plantations\nPrevious Article in Journal\n3D Point Cloud Reconstruction Using Inversely Mapping and Voting from Single Pass CSAR Images\nJournals\nActive Journals Find a Journal Journal Proposal Proceedings Series\nTopics\nInformation\nFor Authors For Reviewers For Editors For Librarians For Publishers For Societies For Conference Organizers\nOpen Access Policy Institutional Open Access Program Special Issues Guidelines Editorial Process Research and Publication Ethics Article Processing Charges Awards Testimonials\nAuthor Services\nInitiatives\nSciforum MDPI Books Preprints.org Scilit SciProfiles Encyclopedia JAMS Proceedings Series\nAbout\nOverview Contact Careers News Press Blog\nSign In / Sign Up\nNotice\nYou can make submissions to other journals here.\nclear\nNotice\nYou are accessing a machine-readable page. In order to be human-readable, please install an RSS reader.\nContinue Cancel\nclear\nAll articles published by MDPI are made immediately available worldwide under an open access license. No special permission is required to reuse all or part of the article published by MDPI, including figures and tables. For articles published under an open access Creative Common CC BY license, any part of the article may be reused without permission provided that the original article is clearly cited. For more information, please refer to https://www.mdpi.com/openaccess.\nFeature papers represent the most advanced research with significant potential for high impact in the field. A Feature Paper should be a substantial original Article that involves several techniques or approaches, provides an outlook for future research directions and describes possible research applications.\nFeature papers are submitted upon individual invitation or recommendation by the scientific editors and must receive positive feedback from the reviewers.\nEditor\u2019s Choice articles are based on recommendations by the scientific editors of MDPI journals from around the world. Editors select a small number of articles recently published in the journal that they believe will be particularly interesting to readers, or important in the respective research area. The aim is to provide a snapshot of some of the most exciting work published in the various research areas of the journal.\nOriginal Submission Date Received: .\nYou seem to have javascript disabled. Please note that many of the page functionalities won't work as expected without javascript enabled.\nclear zoom_out_map search menu\nJournals\nActive Journals\nFind a Journal\nJournal Proposal\nProceedings Series\nTopics\nInformation\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nFor Publishers\nFor Societies\nFor Conference Organizers\nOpen Access Policy\nInstitutional Open Access Program\nSpecial Issues Guidelines\nEditorial Process\nResearch and Publication Ethics\nArticle Processing Charges\nAwards\nTestimonials\nAuthor Services\nInitiatives\nSciforum\nMDPI Books\nPreprints.org\nScilit\nSciProfiles\nEncyclopedia\nJAMS\nProceedings Series\nAbout\nOverview\nContact\nCareers\nNews\nPress\nBlog\nSign In / Sign Up Submit\nerror_outline You can access the new MDPI.com website here. Explore and share your feedback with us. close\nSearch for Articles:\nTitle / Keyword\nAuthor / Affiliation / Email\nJournal\nAll Journals Accounting and Auditing Acoustics Acta Microbiologica Hellenica (AMH) Actuators Adhesives Administrative Sciences Adolescents Advances in Respiratory Medicine (ARM) Aerobiology Aerospace Agriculture AgriEngineering Agrochemicals Agronomy AI AI Chemistry AI for Engineering AI in Education AI in Medicine AI Materials AI Sensors Air Algorithms Allergies Alloys Analog Analytica Analytics Anatomia Anesthesia Research Animals Antibiotics Antibodies Antioxidants Applied Biosciences Applied Mechanics Applied Microbiology Applied Nano Applied Sciences Applied System Innovation (ASI) AppliedChem AppliedMath AppliedPhys Aquaculture Journal Architecture Arthropoda Arts Astronautics Astronomy Atmosphere Atoms Audiology Research Automation Axioms Bacteria Batteries Behavioral Sciences Beverages Big Data and Cognitive Computing (BDCC) BioChem Bioengineering Biologics Biology Biology and Life Sciences Forum Biomass Biomechanics BioMed Biomedicines BioMedInformatics Biomimetics Biomolecules Biophysica Bioresources and Bioproducts Biosensors Biosphere BioTech Birds Blockchains Brain Sciences Buildings Businesses C (Journal of Carbon Research) Cancers Cardiogenetics Cardiovascular Medicine Catalysts Cells Ceramics Challenges ChemEngineering Chemistry Chemistry Proceedings Chemosensors Children Chips CivilEng Clean Technologies (Clean Technol.) Climate Clinical and Translational Neuroscience (CTN) Clinical Bioenergetics Clinics and Practice Clocks & Sleep Coasts Coatings Colloids and Interfaces Colorants Commodities Complexities Complications Compounds Computation Computer Sciences & Mathematics Forum Computers Condensed Matter Conservation Construction Materials Corrosion and Materials Degradation (CMD) Cosmetics COVID Craniomaxillofacial Trauma & Reconstruction (CMTR) Crops Cryo Cryptography Crystals Culture Current Issues in Molecular Biology (CIMB) Current Oncology Dairy Data Dentistry Journal Dermato Dermatopathology Designs Diabetology Diagnostics Dietetics Digital Disabilities Diseases Diversity DNA Drones Drugs and Drug Candidates (DDC) Dynamics Earth Ecologies Econometrics Economies Education Sciences Electricity Electrochem Electronic Materials Electronics Emergency Care and Medicine Encyclopedia Endocrines Energies Energy Storage and Applications (ESA) Eng Engineering Proceedings Entropic and Disordered Matter (EDM) Entropy Environmental and Earth Sciences Proceedings Environments Epidemiologia Epigenomes European Burn Journal (EBJ) European Journal of Investigation in Health, Psychology and Education (EJIHPE) Family Sciences Fermentation Fibers FinTech Fire Fishes Fluids Foods Forecasting Forensic Sciences Forests Fossil Studies Foundations Fractal and Fractional (Fractal Fract) Fuels Future Future Internet Future Pharmacology Future Transportation Galaxies Games Gases Gastroenterology Insights Gastrointestinal Disorders Gastronomy Gels Genealogy Genes Geographies GeoHazards Geomatics Geometry Geosciences Geotechnics Geriatrics Germs Glacies Gout, Urate, and Crystal Deposition Disease (GUCDD) Grasses Green Health Hardware Healthcare Hearts Hemato Hematology Reports Heritage Histories Horticulturae Hospitals Humanities Humans Hydrobiology Hydrogen Hydrology Hydropower Hygiene Immuno Industries Infectious Disease Reports Informatics Information Infrastructures Inorganics Insects Instruments Intelligent Infrastructure and Construction International Journal of Cognitive Sciences (IJCS) International Journal of Environmental Medicine (IJEM) International Journal of Environmental Research and Public Health (IJERPH) International Journal of Financial Studies (IJFS) International Journal of Molecular Sciences (IJMS) International Journal of Neonatal Screening (IJNS) International Journal of Orofacial Myology and Myofunctional Therapy (IJOM) International Journal of Plant Biology (IJPB) International Journal of Topology International Journal of Translational Medicine (IJTM) International Journal of Turbomachinery, Propulsion and Power (IJTPP) International Medical Education (IME) Inventions IoT ISPRS International Journal of Geo-Information (IJGI) J Journal of Aesthetic Medicine (J. Aesthetic Med.) Journal of Ageing and Longevity (JAL) Journal of CardioRenal Medicine (JCRM) Journal of Cardiovascular Development and Disease (JCDD) Journal of Clinical & Translational Ophthalmology (JCTO) Journal of Clinical Medicine (JCM) Journal of Composites Science (J. Compos. Sci.) Journal of Cybersecurity and Privacy (JCP) Journal of Dementia and Alzheimer's Diseas", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/0cbef759-4fa7-4c27-926d-0af604296eda", "content_hash": "7eb9d356a4094356bd2ed13c42ab4b7e7b082c575c4aac96f7be372a7da94dae", "created_at": "2026-03-28T05:11:10.701123316Z"}
{"id": "c15a42d8-b0e0-4503-b3bc-591e782f3e70", "source": "brain", "text": "NLM Support Center \u00b7 NLM Customer Support Center\n\nNLM Support Center \u00b7 NLM Customer Support Center\nYou\u2019re offline. This is a read only version of the page.\nToggle navigation\nNational Library of Medicine\nNational Library of Medicine\nSupport Center Home\nHome\nBrowse Help Topics\nSearch\nMost popular articles\nHow do I obtain the full text of an article?\nHow do I cite NCBI services and databases?\nWhat is a Material Safety Data Sheet (MSDS)?\nWhy do I get error messages when I try to annotate a coding region (CDS) in BankIt?\nWhere can I find information about my health insurance?\nMost recent articles\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nDec 9, 2025\nCan a publisher submit a manuscript to NIHMS for inclusion in PubMed Central on my behalf?\nDec 9, 2025\nWhen will a PMCID be assigned to an NIHMS manuscript?\nOct 8, 2025\nWill a search check my spelling?\nOct 8, 2025\nWhen is required clinical trial results information due?\nTop rated articles\nAug 27, 2025\nWhat are genome assembly accession numbers at NCBI?\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nNov 12, 2019\nHow do I know which Routing Method to use?\nMar 21, 2018\nHow are SNOMED CT files organized?\nNov 20, 2019\nHow do I see the routing history for my Borrow request?\nHealth Literature Drugs & Medical Devices About NLM & NIH My NCBI/Accounts BLAST Submit Data Genes & Genomes ClinicalTrials.gov Getting NLM Data Grants & Funding History of Medicine\nWrite to the help desk\nThe Knowledge Base contains numerous support references, created by our support professionals who have resolved issues for our customers. It is constantly updated, expanded, and refined to ensure that you have access to the very latest information.\n\u200bConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/c15a42d8-b0e0-4503-b3bc-591e782f3e70", "content_hash": "fb1cfe8a4b8f262d7c470e771dd735e46402178ec219bf148d3c1b8d730146ec", "created_at": "2026-03-28T05:11:10.652338731Z"}
{"id": "591c0a28-a223-4328-8662-475c4cea5c1b", "source": "brain", "text": "Optimized Refeeding vs. Standard Care in Malnourished Older Hospitalized Patients: A Prospective, Non-Randomized Cluster-Controlled Study in Geriat...\n\nOptimized Refeeding vs. Standard Care in Malnourished Older Hospitalized Patients: A Prospective, Non-Randomized Cluster-Controlled Study in Geriatric Acute Care\nNext Article in Journal\nPercutaneous Coronary Intervention in Out-of-Hospital Cardiac Arrest Related to Acute Coronary Syndrome: A Literature Review\nPrevious Article in Journal\nAdvanced Age May Not Be an Absolute Contraindication for Radical Nephroureterectomy in Patients with Upper Tract Urothelial Carcinoma: A Single-Center Case Series and a Systematic Review with Meta-Analyses\nJournals\nActive Journals Find a Journal Journal Proposal Proceedings Series\nTopics\nInformation\nFor Authors For Reviewers For Editors For Librarians For Publishers For Societies For Conference Organizers\nOpen Access Policy Institutional Open Access Program Special Issues Guidelines Editorial Process Research and Publication Ethics Article Processing Charges Awards Testimonials\nAuthor Services\nInitiatives\nSciforum MDPI Books Preprints.org Scilit SciProfiles Encyclopedia JAMS Proceedings Series\nAbout\nOverview Contact Careers News Press Blog\nSign In / Sign Up\nNotice\nYou can make submissions to other journals here.\nclear\nNotice\nYou are accessing a machine-readable page. In order to be human-readable, please install an RSS reader.\nContinue Cancel\nclear\nAll articles published by MDPI are made immediately available worldwide under an open access license. No special permission is required to reuse all or part of the article published by MDPI, including figures and tables. For articles published under an open access Creative Common CC BY license, any part of the article may be reused without permission provided that the original article is clearly cited. For more information, please refer to https://www.mdpi.com/openaccess.\nFeature papers represent the most advanced research with significant potential for high impact in the field. A Feature Paper should be a substantial original Article that involves several techniques or approaches, provides an outlook for future research directions and describes possible research applications.\nFeature papers are submitted upon individual invitation or recommendation by the scientific editors and must receive positive feedback from the reviewers.\nEditor\u2019s Choice articles are based on recommendations by the scientific editors of MDPI journals from around the world. Editors select a small number of articles recently published in the journal that they believe will be particularly interesting to readers, or important in the respective research area. The aim is to provide a snapshot of some of the most exciting work published in the various research areas of the journal.\nOriginal Submission Date Received: .\nYou seem to have javascript disabled. Please note that many of the page functionalities won't work as expected without javascript enabled.\nclear zoom_out_map search menu\nJournals\nActive Journals\nFind a Journal\nJournal Proposal\nProceedings Series\nTopics\nInformation\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nFor Publishers\nFor Societies\nFor Conference Organizers\nOpen Access Policy\nInstitutional Open Access Program\nSpecial Issues Guidelines\nEditorial Process\nResearch and Publication Ethics\nArticle Processing Charges\nAwards\nTestimonials\nAuthor Services\nInitiatives\nSciforum\nMDPI Books\nPreprints.org\nScilit\nSciProfiles\nEncyclopedia\nJAMS\nProceedings Series\nAbout\nOverview\nContact\nCareers\nNews\nPress\nBlog\nSign In / Sign Up Submit\nerror_outline You can access the new MDPI.com website here. Explore and share your feedback with us. close\nSearch for Articles:\nTitle / Keyword\nAuthor / Affiliation / Email\nJournal\nAll Journals Accounting and Auditing Acoustics Acta Microbiologica Hellenica (AMH) Actuators Adhesives Administrative Sciences Adolescents Advances in Respiratory Medicine (ARM) Aerobiology Aerospace Agriculture AgriEngineering Agrochemicals Agronomy AI AI Chemistry AI for Engineering AI in Education AI in Medicine AI Materials AI Sensors Air Algorithms Allergies Alloys Analog Analytica Analytics Anatomia Anesthesia Research Animals Antibiotics Antibodies Antioxidants Applied Biosciences Applied Mechanics Applied Microbiology Applied Nano Applied Sciences Applied System Innovation (ASI) AppliedChem AppliedMath AppliedPhys Aquaculture Journal Architecture Arthropoda Arts Astronautics Astronomy Atmosphere Atoms Audiology Research Automation Axioms Bacteria Batteries Behavioral Sciences Beverages Big Data and Cognitive Computing (BDCC) BioChem Bioengineering Biologics Biology Biology and Life Sciences Forum Biomass Biomechanics BioMed Biomedicines BioMedInformatics Biomimetics Biomolecules Biophysica Bioresources and Bioproducts Biosensors Biosphere BioTech Birds Blockchains Brain Sciences Buildings Businesses C (Journal of Carbon Research) Cancers Cardiogenetics Cardiovascular Medicine Catalysts Cells Ceramics Challenges ChemEngineering Chemistry Chemistry Proceedings Chemosensors Children Chips CivilEng Clean Technologies (Clean Technol.) Climate Clinical and Translational Neuroscience (CTN) Clinical Bioenergetics Clinics and Practice Clocks & Sleep Coasts Coatings Colloids and Interfaces Colorants Commodities Complexities Complications Compounds Computation Computer Sciences & Mathematics Forum Computers Condensed Matter Conservation Construction Materials Corrosion and Materials Degradation (CMD) Cosmetics COVID Craniomaxillofacial Trauma & Reconstruction (CMTR) Crops Cryo Cryptography Crystals Culture Current Issues in Molecular Biology (CIMB) Current Oncology Dairy Data Dentistry Journal Dermato Dermatopathology Designs Diabetology Diagnostics Dietetics Digital Disabilities Diseases Diversity DNA Drones Drugs and Drug Candidates (DDC) Dynamics Earth Ecologies Econometrics Economies Education Sciences Electricity Electrochem Electronic Materials Electronics Emergency Care and Medicine Encyclopedia Endocrines Energies Energy Storage and Applications (ESA) Eng Engineering Proceedings Entropic and Disordered Matter (EDM) Entropy Environmental and Earth Sciences Proceedings Environments Epidemiologia Epigenomes European Burn Journal (EBJ) European Journal of Investigation in Health, Psychology and Education (EJIHPE) Family Sciences Fermentation Fibers FinTech Fire Fishes Fluids Foods Forecasting Forensic Sciences Forests Fossil Studies Foundations Fractal and Fractional (Fractal Fract) Fuels Future Future Internet Future Pharmacology Future Transportation Galaxies Games Gases Gastroenterology Insights Gastrointestinal Disorders Gastronomy Gels Genealogy Genes Geographies GeoHazards Geomatics Geometry Geosciences Geotechnics Geriatrics Germs Glacies Gout, Urate, and Crystal Deposition Disease (GUCDD) Grasses Green Health Hardware Healthcare Hearts Hemato Hematology Reports Heritage Histories Horticulturae Hospitals Humanities Humans Hydrobiology Hydrogen Hydrology Hydropower Hygiene Immuno Industries Infectious Disease Reports Informatics Information Infrastructures Inorganics Insects Instruments Intelligent Infrastructure and Construction International Journal of Cognitive Sciences (IJCS) International Journal of Environmental Medicine (IJEM) International Journal of Environmental Research and Public Health (IJERPH) International Journal of Financial Studies (IJFS) International Journal of Molecular Sciences (IJMS) International Journal of Neonatal Screening (IJNS) International Journal of Orofacial Myology and Myofunctional Therapy (IJOM) International Journal of Plant Biology (IJPB) International Journal of Topology International Journal of Translational Medicine (IJTM) International Journal of Turbomachinery, Propulsion and Power (IJTPP) International Medical Education (IME) Inventions IoT ISPRS International Journal of Geo-Information (IJGI) J Journal of Aesthetic Medicine (J. Aesthetic Med.) Journal of Ageing and Longevity (JAL) Journal of CardioRenal Medicine (JCRM) Journal of Cardiovascular Development and Disease (JCDD) Journal of Clinical & Translational Ophthalmology (JCTO) Journal", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/591c0a28-a223-4328-8662-475c4cea5c1b", "content_hash": "cc7c44dfb9678d4f1a87a06c6b20d0a9cf377ab7c226d3293326d70fdb8d9c16", "created_at": "2026-03-28T05:11:10.647688638Z"}
{"id": "0994b39e-8c17-4acf-ae41-26bf2cf3ae9a", "source": "brain", "text": "Involving Micro and Small Enterprises in the Energy Transition: Evidence from Poland | MDPI\n\nInvolving Micro and Small Enterprises in the Energy Transition: Evidence from Poland | MDPI\nSkip Content\nYou are currently on the new version of our website. Access the old version\nhere\n.\nClose\nJournals\nAll Journals\nJournal Finder\nProceedings Series\nPropose a Journal\nTopics\nBy Subjects\nBiology & Life Sciences\nBusiness & Economics\nChemistry & Materials\nComputer Science & Mathematics\nEngineering\nEnvironmental & Earth Sciences\nMedicine & Pharmacology\nPhysical Sciences\nPublic Health & Healthcare\nSocial Sciences, Arts & Humanities\nOur Topics\nAll Topics\nAbout Topics\nTopics Awards\nSubject Editors\nPropose a Topic\nAuthor Services\nInformation\nPublishing\nOpen Access Policy\nEditorial Process\nPublication Ethics\nSpecial Issues Guidelines\nArticle Processing Charge\nPublishing Services\nGuidelines\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nPartnerships\nSocieties\nConferences\nInstitutional Open\nAccess Program\nAbout\nCompany\nAbout Us\nMission\nImpact\nHistory\nLeadership\nOffice Locations\nAwards\nCareers\nProducts\nMedia\nNews\nBlog\nContact\nSupport\nSend Feedback\nSearch\nOpen mobile navigation\nHome\nJournals\nEnergies\nVolume 17\nIssue 4\n10.3390/en17040847\nEnergiesEnergies\nOpen Cite\nCite\nOpen Share\nShare\nDownload PDF\nMore formats\nAbstractIntroductionEnergy Transition Challenges for BusinessesResearch MethodologyResultsDiscussion and ConclusionsAuthor ContributionsFundingData Availability StatementConflicts of InterestReferencesArticle Metrics\nArticle\n11 February 2024\nInvolving Micro and Small Enterprises in the Energy Transition: Evidence from Poland\nTomasz Bernat1\n,\nSylwia Flaszewska2\n,\nRenata Lisowska3,*\nand\nKatarzyna Szyma\u0144ska2\n1\nEconomics Department, Institute of Economics and Finance, University of Szczecin, 64 Mickiewicza Street, 71-101 Szczecin, Poland\n2\nDivision of Strategic Management, Institute of Management, Faculty of Organization and Management, Lodz University of Technology, 221 W\u00f3lcza\u0144ska Street, 93-005 Lodz, Poland\n3\nDepartment of Entrepreneurship and Industrial Policy, Faculty of Management, University of Lodz, 22/26 Matejki Street, 90-237 Lodz, Poland\n*\nAuthor to whom correspondence should be addressed.\nEnergies2024, 17(4), 847;https://doi.org/10.3390/en17040847\nThis article belongs to the Special Issue Transition of the Energy Systems and the Development of Urban Functional Areas\nVersion Notes\nOrder Reprints\nAbstract\nThe energy transition is one of humanity\u2019s most significant challenges. All micro, small, medium, and large enterprises will have to face it, and some are already making progress. This paper focuses on the involvement of the smallest actors in the energy transition. Micro and small enterprises comprise the largest part of the economy and significantly impact its development. Concerning the broad scope of their activities, these entities are characterized by a specific owner\u2013manager relationship. This means that the final decision is influenced by business objectives, the manager\u2019s approach, their awareness of change, and personal and other factors. Based on the analysis of data from 400 companies, it was found that the involvement of micro and small enterprises in the energy transition is related to their market and financial success.\nKeywords:\nenergy transition; micro and small enterprises; energy efficiency; involvement in the energy transition; market and financial results\n1. Introduction\nTransformation is a long-term change process resulting from economic, social, technological, institutional and/or environmental development. This process also involves energy systems, which, as we know, are not static. Energy transition is a complex and difficult process to describe [1,2,3]. It is expected to contribute to the goals within the realm of sustainable development and the European Green Deal. It will only be possible through the industry\u2019s commitment to actions for a more sustainable economy [4,5,6].\nInnovative solutions must be promoted to move smoothly through this process, and governments and companies must invest in technologies based on renewable energy sources. For these activities to be effective, all organizations must participate, including those in the micro and small business sectors [7]. Promoting these processes from the viewpoint of micro and small-sized companies indicates the necessity of adopting a broad perspective on external conditions for developing activities mainly related to the transfer and financing of technological solutions [8]. To strengthen their position in the market and increase the scope of energy transition, the indicated enterprises often have to seek assistance from external sources. Researchers point to the economic benefits of efforts to transition energy. They suggest that the digitization and efficiency of energy consumption activities have an increasing impact on the market and financial performance of pre-enterprises. This is associated with a reasonably fast payback period, which for small projects is only about 3 to 5 years [9]. From an economic perspective, environmental effects are significant. The economic cost\u2013benefit relationship focuses on the growth model associated with maximizing production or service delivery with less energy and resource consumption. Such a value-based approach leads to currently relevant considerations about the purpose of trade and the nature of what is simultaneously beneficial to the business development of the environment in which it operates. Such activities, supported by a broad range of tools and applications, will increase the potential of micro and small businesses to make a genuine and lasting difference in reducing their impact on their part of the environment [10,11].\nIn light of this, a vital factor in determining the development of businesses in line with the energy transition is collaborating with the environment of these entities. In addition to external adaptation, the internal dimension of the environment of a given enterprise is also crucial in the literature. Under the complete or potential control of a given entity includes various resources used in the management process (i.e., financial, human, physical, and information) that support the development of energy transition [4,12]. It is, therefore, necessary to strive to build open relations between different sectors to support activities aimed at energy transformation. Strong promotion of energy investments for micro and small businesses will arouse the involvement of their owners in these ventures.\nRespecting features such as flexibility, entrepreneurship, and innovation is key to implementing environmental programs and increasing the competitiveness of enterprises [13,14].\nTherefore, promoting energy transition in micro and small companies is a direction that builds a new quality of their functioning in the market. Therefore, both the role and tasks of the entrepreneur themself are changing. You should also be aware that in crises, these conditions may become critical barriers that have a negative impact on energy transition [15,16,17].\nTaking into account that micro and small entities are the most significant part of the economy, have a great influence on its development, and look at the wide scale of their activities, a specific owner\u2013manager relationship distinguishes these entities. This means that business goals influence the final decision making process, the manager\u2019s approach, their awareness of changes, and personal and other factors. Therefore, the area of energy transition for micro and small businesses should be intensively studied by researchers. Polish and foreign researchers have already studied the relationship between the management process, energy transition, and sustainability [18,19,20]. Although discussion of the energy transition touches on financial and market issues and effects [20] more often in large companies, it rarely refers to micro and small companies. The discussion in this area is legitimate because it is essential for realizing environmental goals to develop energy t", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/0994b39e-8c17-4acf-ae41-26bf2cf3ae9a", "content_hash": "2436ba22d7af8a8aa1f74d2edd0fd642a41049615b273208d6a9a7abc39f3cee", "created_at": "2026-03-28T05:11:10.592840551Z"}
{"id": "16b5440e-6a72-4d01-b1df-782d1019792d", "source": "brain", "text": "CDD Conserved Protein Domain Family: PRK08243\n\nCDD Conserved Protein Domain Family: PRK08243\nConserved Protein Domain Family\nPRK08243\nEntrez CDD Structure Protein Help\n?\nPRK08243: PRK08243\nDownload alignment\n4-hydroxybenzoate 3-monooxygenase; Validated\nLinks\n?\nSource: PRK\nTaxonomy: Bacteria\nProtein: Representatives\nSpecific Protein\nRelated Protein\nRelated Structure\nArchitectures\nSuperfamily: cl21454\nStatistics\n?\nPSSM-Id: 236198\nAligned: 164 rows\nThreshold Bit Score: 488.539\nCreated: 9-Dec-2010\nUpdated: 25-Oct-2021\nStructure\n?\nAligned Rows:\nDownload Cn3D\nSequence Alignment\ninclude consensus sequence ?\nFormat: Hypertext Plain Text mFasta Compact Hypertext Compact Text Row Display: Color Bits: 0.5 bit 1.0 bit 1.5 bit 2.0 bit 2.5 bit 3.0 bit 3.5 bit 4.0 bit Identity Type Selection: top listed sequences the most diverse members\n\n109900192 4 VKTKVAIIGAGPSGLLLGQLLAKQGIDNIIVERVSGEYVLGRIRAGILEQGLVDLLREANVNERMDGEGHVHDGFEISYY 83 \n300713295 6 EETKVAIIGAGVAGLTLATFLQKSGVPCVVLERRNRTYVEVRQRAGVVEARGVEMFERWGLADKLLA-GPVAQTIDYRVN 84 \n300783217 3 EHTTVVIVGAGVAGLTLGNILLRNGIDCVILEKYGREHVEQRQRAGTIDSRGVRMFREWGLEEVLAHDAPTEVDAGFFLD 82 \n134100570 4 VRTRVAVVGAGPSGLLLSHLLHTQGIDSVVLERRSREHVESRVRAGMLEQGVADLIRQAGVGARMDREGFVHDGFELRIG 83 \n21219815 14 RGISVVVVGAGPAGLTVGSILRAAGVGCLVLETATREVVEHRPRAGVIEEWAVRGLARRGLARTLLERAQAHTECEFRFA 93 \n290962740 17 MHTTVGIIGGGPAGLLLARLLHNAGIDSVVLERKDRAYVEQRQRAGILEQATVDVLRSAGAGARLDAEGIPHDGIELRYD 96 \n29830060 1 MRTTVGIIGAGPAGLLLARLLRNAGIDSVVLESRDRAYVERRQRAGILEQGTVDVLRAAGAGERMDREGLRHDGIELRFD 80 \n256394023 1 MHTTVGIIGAGPAGLLLARLLHQAGVDSVVLEARDREYVEQRQRAGILEQVTVDALRAAGAGERMDREGIVHHGIELRFA 80 \n256422806 10 EKTQVVIIGAGVSGLTLATFLQKSGVACVIVERRNRAYIEMRQRAGVVEARGVHMFERWGLADKLLG-GPVAQTIDYRVN 88 \n296270791 2 MRTTVGIVGGGPAGLLLARLLRRSGIDCVVLESRDRAYVEQRQRAGILEQGAADILRECGAGERMDREGLVHDGIELRFA 81 \n\n109900192 84 GTPYRIDL--NKLTDGKTVMCYGQTEVTRDLMQA-RETKALTTYYSASDVSLHD------IESAHPTVTF--SQDGVNYT 152\n300713295 85 GVGRIFDI---GAEGDAQSRFCTQQMLVNNLLRElIDAMAGDVRFEVADVVITN------EADRRPSVAY--SDAGGHHE 153\n300783217 83 GEELPIDF----SADDNDSVFLPQQVLVRNLTDA-FLRAGGDLRFEADSITLEN--------LEHPVVRY------GDNV 143\n134100570 84 DRRHRVSL--TGLT-GRTVCMYGQQELVKDLIRA-RTEAAATLHFGVEDVKLHG------LTGDAPVVRC--TIDGEPTE 151\n21219815 94 GERYRFGY--TGLT-GRHHFVYPQQFLVTDLVREyADVRGGEIRFGVRDVRLHG------TGSARPAVSYvcPDSGERRV 164\n290962740 97 GRAHRVDF--PGLTGGRRVWVYAQTEVVKDLIAL-QLTGGGPLLFEAEVHAVEG------ADTDRPSIRY--THEGREQT 165\n29830060 81 RRRHRVDF--PALAGGRAVMVYAQTEVCKDLIAL-QLEEGGPLLFGAEALAVEG------AGTERPRVPF--THEGREDV 149\n256394023 81 GRSQRIDF--AVLAGGRGVMVYAQTEMVKDLIAL-HLAHGGPLLFEAGVSSVGAvgavgtADDDRIAVRY--RRDGREQT 155\n256422806 89 GVGRVFEIvgDDRIQGRFCT---QQMLVNNLLKElIDGMSGDVRFEVTDVQIKN------EEGVQPEVTY--RYADSEHV 157\n296270791 82 RRSHRIDF--PSLTGGRRVMVYAQTEVVKDLIRL-HLEDGTPLLFEATATAITG------IDADRPVIHF--VHEGREKT 150\n\n109900192 153 LECDYIAGCDGFHGVSRKSIPEEKRNEFERVYPFGWLGLLSDTPPVSDELIYCKTERGFALASMRSSSRSRYYLQVPLTD 232\n300713295 154 IACDFIVGCDADRGVSRASIPDGILTRYVHEFGYAWMAALVEA-PVTGDPIMAVSDHGFVGQLPRGPQRSRYYLQCALTD 232\n300783217 144 VTAGFIAGCDGDRGVSRTAFPAGVLTRYSREYGYAWLSVLAEVPANPSGM--AIHSRGLAGMLPRGPHASRTYLQCALDD 221\n134100570 152 ITCDFVAGCDGFHGVSRRSVPASALSVYEHEYPFAWLGVLARMPPVASELVYSAHERGFALYSMRTESLSRLYLQVAPDD 231\n21219815 165 VEADFVAGCDGARGVTRASLPAGRVRLARHDYGVGWLALLAEAPPSSDCVVFGMHPRGFAGHMARSPEVTRYYLQCPPGD 244\n290962740 166 LTCDYVVGCDGFHGVARDAVPDGVRTTYERTYPYSWLGILADAPPVYDELIYAHSERGFALASMRSPSVSRLYLQVPNGT 245\n29830060 150 LECDYVVGCDGFRGVARQAVPAEVSRVFERTYPFGWLGVLADVAPSHDELVYARHERGFALLSMRSPAVSRLYLQVPEGT 229\n256394023 156 LTCDWAVGCDGFHGVTKDAVPADLRHTYERTYPYSWLGILADAPPVYDELIYAHSDRGFALASMRSDTVSRLYLQVPNGT 235\n256422806 158 LVCDYIVGCDGDRGVSRASIPEGILTKYSHEFGYAWLAALVEAPVTGHPIM-GVSDHGCVAQLPRGPHRSRYYLQCALSD 236\n296270791 151 LTCEYVVGCDGFHGITREAIRGAI-TTYEHVYPYSWLGILADVPPSCDELIYAHSERGFALHSMRGRTVSRLYLQVPNGS 229\n\n109900192 233 KVEQWSDERFWDELRKRLP--QEAASNLITGPSLEKSIAPLRSFVCEPMQLGKLFLVGDAAHIVPPTGAKGLNLAASDVS 310\n300713295 233 TAEDWPEKRIWDEIRVRLN--D---DTIQNAVVHNIDFVPLRSVVYAPMQYGNLFLAGDAAHMVPPASAKGMNMALYDVD 307\n300783217 222 DLAQWPDERVWSELEARFG------RPVASGRIADKRLVPLRNVVHSPMQSGKLHLLGDAAHIVPPMSAKGIHLALFDAE 295\n134100570 232 DGSTWPPELIWKELATRLG--PDASEVLRPGPILETSVTRMRGFVAEPMQYGRLFLAGDAAHIVPPTAAKGLNLAVGDVR 309\n21219815 245 SPENWPHERVWAELRERLG--AAGAPPLAEGRLIEKRVLDMHSYVVEPMAFGRLFLAGDAAHLTAPIAAKGLNLALHDAF 322\n290962740 246 DPGDWSDERIWDELDARLAltANPGWRLKRGPVTSKAVLPMRSHVTEPMRYGRVFLAGDAAHIVPPTGAKGLNLAATDVI 325\n29830060 230 DAEAWADDEIWAELERRFE--TDDAWRLERGPITQKSVTPMRGYVHEPMRHGRLFLAGDAAHIVPPTGAKGLNLAVGDVV 307\n256394023 236 DPAAWSDDRIWDELDRRFAtrADPGWKLTRGPITAKSVLPMRSHVTEPMRHGRVLLAGDTAHIVPPTGAKGLNLATGDVI 315\n256422806 237 GAQDWPDDRLWNEIRLRLQ--D---ETIQNVKVHDKFFVPLRSVVYAPMQYRHLYLAGDAAHLVPPASAKGMNLALFDVD 311\n296270791 230 GVDEWPDDRIWDELDARFA--IDGDWKLERGPITSKAVLPMRSFVTEPMRHRRVFLAGDAAHIVPPTGAKGLNLALGDVA 307\n\n109900192 311 TLYRLLTKEYNEGATNASQQYSEIALRRVWHAERFSWWMSNMLHEFtdcgGDANNMDnktfERFMASELDFYLSHQEGQQ 390\n300713295 308 VLAQALLDAVRNQDRRTLDSYTDTCLPRIWNYQDFAVWMTDTMHDAsn-pAQQGTFR----QMTARSRLNNLFASPAAAR 382\n300783217 296 VFARGVIRQAKENDPSLLDSYSETCLSHVWNYQAFAAWITDIMHDA-----GDASYAgefrKRVARAELERQFTSAAAGR 370\n134100570 310 TLAQAFARWYSSGDRGPLDEYSATCLPAVWRAQEFSAAMTWLLHRP----ADSTGFT----ERLRRSRLENLVSSRAAAT 381\n21219815 323 LLGDGLVAALTKGDDSALAGYSDACLARVWDYQEFSQWLAEMYHGT----ASGDPYR----AGAALARLRRLFSSPAAAA 394\n290962740 326 VLARAFARLRETGSTELLDAYSDTCLRRVWRAEHFSYFMTTTLHAD----PDQSPFE----TRLQLAQLDRVATSRHAAA 397\n29830060 308 TFARALTHLKETGSGERLDAYSATCLRRVWQAERFSYDMTTLLHRP----PAATPFE----ERVQLARLERITSSRAAEA 379\n256394023 316 ILARALAHWKETGSAELLDAYSDTCLERVWRAEHFSYFMTTTLHVD----PDQSAFD----TRLQLSQLARIAASPHAAA 387\n256422806 312 ILAQGLLQALQHNDHTALLNYSDTCLPHIWKYQEFAVWMTDMMHDAgd-pTQHGTFY----QMIARARLDNLFSSPIAAH 386\n296270791 308 VLARAFIYLHTTGSSELLDAYSDTRLRRVWRAEHFSYFMTTTLHLG----PEQTPFQ----TRLQLAQLERIVTSRAAAA 379\n\n109900192 391 VIATQYVGMPY 401\n300713295 383 LHGEYQRGTN- 392\n300783217 371 LFAEFMAGVA- 380\n134100570 382 EFAENYVGVSR 392\n21219815 395 EFAERYLGVRT 405\n290962740 398 ELAENYTGLSL 408\n29830060 380 DLAEGYTGSPW 390\n256394023 388 ELAQNYVGIPI 398\n256422806 387 QHSEYQRGML- 396\n296270791 380 ELAENYTGLPL 390\nCiting CDD\nJiyao W et al.(2023). \"The conserved domain database in 2023.\", Nucleic Acids Res. 51(D1):D384-D388.\n| Disclaimer | Privacy statement | Accessibility |", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/16b5440e-6a72-4d01-b1df-782d1019792d", "content_hash": "110fd7ec7fb3f7c902f2eabbf0767a3524065c727c969cbaa0322a46ffd3aeca", "created_at": "2026-03-28T05:11:10.582732899Z"}
{"id": "15ab05a7-c54a-4c81-9fce-2a4e1f22ea0b", "source": "brain", "text": "\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad-\u8db3\u7403\u76f4\u64ad|\u6b27\u51a0\u76f4\u64ad|\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206|\u82f1\u8d85\u76f4\u64ad\u514d\u8d39\u76f4\u64ad\u89c6\u9891\u76f4\u64ad|\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u5b98\u7f51\n\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad-\u8db3\u7403\u76f4\u64ad|\u6b27\u51a0\u76f4\u64ad|\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206|\u82f1\u8d85\u76f4\u64ad\u514d\u8d39\u76f4\u64ad\u89c6\u9891\u76f4\u64ad|\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u5b98\u7f51\nToggle navigation\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\n\u9996\u9875\n\u8db3\u7403\u76f4\u64ad\n\u7bee\u7403\u76f4\u64ad\n\u82f1\u8d85\u76f4\u64ad\n\u6b27\u51a0\u676f\u76f4\u64ad\n\u897f\u7532\u76f4\u64ad\n\u6fb3\u8d85\u76f4\u64ad\n\u5fb7\u7532\u76f4\u64ad\n\u6cd5\u7532\u76f4\u64ad\n\u4e2d\u8d85\u76f4\u64ad\n\u610f\u7532\u76f4\u64ad\n\u6b27\u8054\u76f4\u64ad\n\u6b27\u534f\u8054\u76f4\u64ad\n\u4e16\u6b27\u9884\u76f4\u64ad\n\u4e16\u4e9a\u9884\u76f4\u64ad\nNBA\u76f4\u64ad\nCBA\u76f4\u64ad\n\u8db3\u7403\u65b0\u95fb\n\u7bee\u7403\u65b0\u95fb\n\u8db3\u7403\u89c6\u9891\n\u7bee\u7403\u89c6\u9891\n\u9996\u9875\n\u7bee\u7403\u76f4\u64ad\n\u8db3\u7403\u76f4\u64ad\n\u8db3\u7403\u65b0\u95fb\n\u7bee\u7403\u65b0\u95fb\n\u8db3\u7403\u89c6\u9891\n\u7bee\u7403\u89c6\u9891\n\u9996\u9875 >\n\u672c\u573a\u7531\u6bd4\u8d5b\u5df2\u7ecf\u5706\u6ee1\u7ed3\u675f\uff0c\u611f\u8c22\u60a8\u7684\u5173\u6ce8\u4e0e\u652f\u6301\uff01\n\u5982\u679c\u60a8\u9519\u8fc7\u4e86\u672c\u573a\u76f4\u64ad\uff0c\u4e0d\u7528\u62c5\u5fc3\uff0c\u9875\u9762\u4e0b\u65b9\u5c06\u63d0\u4f9b\u5168\u573a\u5f55\u50cf\u56de\u653e\u4e0e\u8fdb\u7403\u96c6\u9526\uff0c\u65b9\u4fbf\u60a8\u968f\u65f6\u91cd\u6e29\u6bd4\u8d5b\u7cbe\u5f69\u77ac\u95f4\u3002\n\u60f3\u770b\u66f4\u591a\u7684\u76f4\u64ad\u6216\u4e86\u89e3\u5176\u4ed6\u8db3\u7403\u6bd4\u8d5b\u3001\u7bee\u7403\u8d5b\u4e8b\uff1f \u6b22\u8fce\u7ee7\u7eed\u5173\u6ce8\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\uff0c\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u5c06\u6301\u7eed\u66f4\u65b0\u8d5b\u7a0b\u3001\u6bd4\u5206\u7ed3\u679c\u3001\u5168\u573a\u5f55\u50cf\u4e0e\u9ad8\u5149\u96c6\u9526\u7b49\u5185\u5bb9\u3002\n\u76f8\u5173\u8d5b\u7a0b\n\u6682\u65e0\u8d44\u6599\n\u70ed\u95e8\u65b0\u95fb\n\u5df4\u897f\u8fb9\u950b\u52a0\u5e03\u91cc\u57c3\u5c14\u91cd\u8fd4\u6d77\u6e2f\uff0c\u5415\u6587\u541b11\u53f7\u7403\u8863\u6709\u671b\u4f20\u627f\n\u82f1\u8d8524\u8f6e\uff0c\u5229\u7269\u6d664-1\u7ebd\u5361\u65af\u5c14\uff0c\u6770\u62c9\u5fb7\u79f0\u57c3\u57fa\u8482\u514b\u50cf\u6258\u96f7\u65af\n\u6b66\u6c49\u4e09\u9547\u5b98\u65b9\u5ba3\u5e03\uff1a\u5580\u9ea6\u9686\u56fd\u811a\u4e9a\u59c6\u5361\u59c6\u52a0\u76df\uff0c\u80fd\u5426\u52a9\u961f\u91cd\u8fd4\u4e2d\u8d85\u8363\u5149\uff1f\n\u6b27\u51a0\u5c0f\u7ec4\u8d5b\u7b2c8\u8f6e\u5b8c\u7ed3\uff0c12\u573a\u5927\u6218\u60ac\u5ff5\u8fed\u8d77\uff01\n\u57c3\u5229\u5965\u7279\u503a\u52a1\u8fd8\u6e05\uff0cAC\u7c73\u5170\u7ba1\u7406\u5c42\u4e0d\u52a8\u8361\uff0c\u672a\u6765\u51e0\u5929\u5b9a\u65b0\u8463\u4e8b\u4f1a\n\u83ab\u6d3e\u79df\u501f\u585e\u7ef4\u5229\u4e9a\uff0c\u8c03\u4f83XO\u5c0f\u7f16\u7ec8\u7ed3\u9694\u7a7a\u5bf9\u8bdd\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\n\u5173\u4e8e\u6211\u4eec \u8054\u7cfb\u6211\u4eec\n\u7f51\u7ad9\u5730\u56fe Copyright \u00a9 \u7248\u6743\u6240\u6709 2025\n\u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u6574\u5408\u8db3\u7403\u76f4\u64ad\u3001\u6b27\u51a0\u76f4\u64ad\u548c\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206\u7b49\u591a\u9879\u4f53\u80b2\u6570\u636e\uff0c\u4e3a\u7403\u8ff7\u63d0\u4f9b\u5168\u65b9\u4f4d\u7684\u8d5b\u4e8b\u4fe1\u606f\u5e73\u53f0\u3002 \u9ed1\u767d\u4f53\u80b2\u76f4\u64ad\u4ee5\u6b27\u51a0\u76f4\u64ad\u3001\u82f1\u8d85\u76f4\u64ad\u514d\u8d39\u76f4\u64ad\u89c6\u9891\u76f4\u64ad\u3001\u6377\u62a5\u6bd4\u5206\u8db3\u7403\u5373\u65f6\u6bd4\u5206\u7b49\u8d5b\u4e8b\u4e3a\u6838\u5fc3\u5185\u5bb9\uff0c\u63d0\u4f9b\u9ad8\u6e05\u8d5b\u4e8b\u76f4\u64ad\u3001\u4e13\u4e1a\u5206\u6790\u4e0e\u6743\u5a01\u62a5\u9053\uff0c\u8986\u76d6NBA\u3001\u6b27\u51a0\u3001\u82f1\u8d85\u76f4\u64ad\u7b49\u591a\u9879\u8d5b\u4e8b\u3002\u5e73\u53f0\u66f4\u65b0\u8fc5\u901f\u3001\u6570\u636e\u8be6\u5b9e\uff0c\u81f4\u529b\u4e8e\u4e3a\u7403\u8ff7\u6253\u9020\u5168\u9762\u3001\u6d41\u7545\u7684\u89c2\u8d5b\u4f53\u9a8c\uff0c\u8ba9\u4f53\u80b2\u7231\u597d\u8005\u968f\u65f6\u638c\u63e1\u6700\u65b0\u52a8\u6001\uff0c\u4eab\u53d7\u771f\u5b9e\u800c\u7cbe\u5f69\u7684\u4f53\u80b2\u4e16\u754c\u3002", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/15ab05a7-c54a-4c81-9fce-2a4e1f22ea0b", "content_hash": "18e8823827f1a1abc1856f6a12f7dc75a9ae6c0d61972a94a6caba8449baa117", "created_at": "2026-03-28T05:11:10.582687159Z"}
{"id": "fabd6a20-0345-4027-b447-60986758ddff", "source": "brain", "text": "Dok je on zatvoren u sobi \u201c\u017evrljao\u201d po papiru, ona je prodavala sve \u0161to je imala da bi pre\u017eivali: 13 godina je \u010dekala da je o\u017eeni, a ovim re\u010dima je...\n\nDok je on zatvoren u sobi \u201c\u017evrljao\u201d po papiru, ona je prodavala sve \u0161to je imala da bi pre\u017eivali: 13 godina je \u010dekala da je o\u017eeni, a ovim re\u010dima je osvojio | Brze i provjerene vijesti\nPo\u010detna\nNovo\nRegion\nDom i vrt\nRecepti\nSavjeti\nShowbizz\nZdravlje\nSearch\nFriday, February 6, 2026\nPo\u010detna\nO nama\nKontakt\nPravila i uslovi kori\u0161tenja\nPrivacy policy\nBrze i provjerene vijesti\nPo\u010detna\nNovo\nRegion\nDom i vrt\nRecepti\nSavjeti\nShowbizz\nZdravlje\nHome Novo Dok je on zatvoren u sobi \u201c\u017evrljao\u201d po papiru, ona je prodavala...\nNovo\nRegion\nShowbizz\nDok je on zatvoren u sobi \u201c\u017evrljao\u201d po papiru, ona je prodavala sve \u0161to je imala da bi pre\u017eivali: 13 godina je \u010dekala da je o\u017eeni, a ovim re\u010dima je osvojio\nBy\nRedakcija\n-\nApril 27, 2025\n789\n0\nShare\nFacebook\nTwitter\nGoogle+\nPinterest\nWhatsApp\nU dana\u0161njem \u010dlanku \u017eelim da vam ispri\u010dam pri\u010du koja se dogodila pre mnogo godina, ali koja i dalje inspiri\u0161e i dirnuti svakog ko je pro\u010dita.\nOva pri\u010da govori o ljubavi, strpljenju, poverenju i verovanju u snove, a glavni akteri su jedan od najve\u0107ih pisaca 20. veka i \u017eena koja je u svakom smislu bila njegova podr\u0161ka, njegova inspiracija, a i kamen-temeljac u \u017eivotu.\nImala je samo 13 godina kada joj je rekao: \u201eBudi moja \u017eena.\u201c Bilo je to na plesnom podijumu, dok je mr\u0161avi de\u010dak sa iskrom u o\u010dima pri\u0161ao i rekao: \u201eUpravo sam shvatio da su sve moje pesme o tebi. Udaj se za mene!\u201c Njegov pogled bio je pun strasti i nade, a re\u010di su bile iskrene, iako nisu bile ozbiljno shva\u0107ene. Devojka, mlada i jo\u0161 uvek nedovoljno odrasla da razmi\u0161lja o braku, podigla je pogled prema njemu i mirno odgovorila: \u201eU redu. Ali pusti me da prvo zavr\u0161im \u0161kolu.\u201c Tada, na tom plesnom podijumu, zapo\u010dela je pri\u010da koja je kasnije postala legendarna.\nOn je bio Gabrijel Garsija Markes, a ona je bila Mercedes. Dugo su \u010dekali, ali ljubav koju su gajili bila je nepokolebljiva. Njihova veza nije bila samo pri\u010da o romanti\u010dnom anga\u017emanu, ve\u0107 pri\u010da o podr\u0161ci i poverenju, o tome kako je ljubav, \u010dak i kada nije zvani\u010dno ozvani\u010dena, naj\u010distiji oblik zajedni\u0161tva. Ven\u010dali su se tek 13 godina kasnije. Iako nisu bili zvani\u010dno vereni, Markes je kasnije rekao: \u201eNismo \u010dekali ven\u010danje, samo smo strpljivo \u010dekali ono \u0161to je trebalo da bude.\u201c\nDok je Gabrijel bio zatvoren u svojoj sobi, pi\u0161u\u0107i remek-delo \u201eSto godina samo\u0107e\u201c, Mercedes je bila ta koja je nosila ceo njihov svet. Njena vernost, njeno poverenje u njegov talenat, i njena posve\u0107enost porodici nisu bile samo znakovi ljubavi, ve\u0107 i njene nepopustljive nade da \u0107e on jednog dana ostvariti sve \u0161to je zamislio. Verovala je u njega \u010dak i kada su okolnosti bile te\u0161ke, kada su novci bili ograni\u010deni, a snovi su delovali daleko. Bez obzira na sve, nikada nije sumnjala da je njen mu\u017e genije, i nikada nije napustila njegov san.\nKada je rukopis njegovog dela bio gotov, nisu imali dovoljno novca da ga po\u0161alju. Mercedes je tada u\u010dinila ne\u0161to \u0161to \u0107e se kasnije \u010diniti kao herojski potez. Prodala je svoje poslednje stvari, kao \u0161to su fen za kosu i blender, da bi poslala rukopis na adresu izdava\u010da. Ova \u017ertva, u kojoj se prepoznao njen duboki ljubavni odnos prema Markesu, pokazala je koliko je ona verovala u njegovu misiju i njegov talenat. Nije se \u017ealila, niti se kajala, jer je znala da je to bio korak ka ne\u010demu ve\u0107em od nje, ne\u0161to \u0161to je bilo daleko od trenutnih problema i nesigurnosti.\nMesecima kasnije, svet je saznao ime Gabrijela Garsije Markesa. Njegovo delo, roman \u201eSto godina samo\u0107e\u201c, zauvek je promenio knji\u017eevnost. Ovaj roman nije samo postao najva\u017eniji deo knji\u017eevnog kanona Latinske Amerike, ve\u0107 je doneo Markesu i Nobelovu nagradu za knji\u017eevnost. Bez obzira na njegov kasniji uspeh, va\u017eno je shvatiti da bi bez Mercedesine podr\u0161ke, \u017ertve i vere u njega, Markes mo\u017eda nikada ne bi dostigao svoj potencijal. Njegov uspeh nije bio samo njegov, ve\u0107 i njihov, jer je bio rezultat godina zajedni\u010dke borbe, ljubavi i uzajamnog po\u0161tovanja.\nOva pri\u010da je sna\u017ena podse\u0107anja na to kako ljubav i podr\u0161ka izme\u0111u dvoje ljudi mogu stvoriti nevjerovatne stvari. Gabrijel Garsija Markes postao je svetli primer toga kako ljubav i vera u partnera mogu oblikovati ne samo njihove \u017eivote, ve\u0107 i svet oko njih. Mercedes je bila ta koja je tiho, ali neizmerno zna\u010dajno, doprinosila njegovom uspehu, iako nikada nije tra\u017eila priznanje. Njena ljubav bila je \u010dista, nepokolebljiva, i u tom njenom verovanju u njega le\u017ei klju\u010d svega \u0161to su postigli zajedno.\nPlease leave this field empty\nPRIRODNI LIJEKOVI\n\u22c6 BESPLATNO ZA TEBE \u22c6\nUpi\u0161i svoj email i preuzmi priru\u010dnik 'Ljekovito bilje'! Nau\u010di tajne prirodnih lijekova i otkrij kako posti\u0107i ravnote\u017eu i zdravlje uz pomo\u0107 \u010dudesnih biljaka.\nJednim klikom preuzmi priru\u010dnik s najboljim prirodnim lijekovima!\nYou\u2019ve been successfully subscribed to our newsletter!\nShare\nFacebook\nTwitter\nGoogle+\nPinterest\nWhatsApp\nPrevious article\u0160ta se de\u0161ava u Sikstinskoj kapeli dok se bira novi Papa? Ekstremno tajni proces korene vu\u010de jo\u0161 iz srednjevekovnih vremena, a evo \u0161ta zna\u010de beli i crni dim\nNext article\u201cNon-stop smo vodili ljubav, jo\u0161 ako je bilo zabranjeno\u2026\u201d: Jasmina nije mogla da se zasiti na\u0161eg pisca, dok je umirao \u017ealila je \u0161to vi\u0161e ne\u0107e deliti postelju\nRedakcija\nRELATED ARTICLESMORE FROM AUTHOR\nNovo\nGDJE NA LICU IMATE MLADE\u017d \u2013 SVAKI IMA ZNA\u010cENJE: Odmah prona\u0111ite broj i otkrijte \u0160TA TO GOVORI O VAMA\nShowbizz\nI\u0161ao na hemioterapiju, pa dr\u017eao koncert u \u010ca\u010dku: Pred publikom nikad nije stajao jer nije ose\u0107ao noge, majka ga u 35. ispratila na ve\u010dni...\nNovo\nFEBRUAR DONOSI OGROMNE PROMJENE: Neka se Ribe, \u0160korpija i OVAJ znak pripreme na najuzbudljivije \u017eivotne promjene i preokrete do sad!\nNajnovije\nTrudnica poni\u017eena pred porodicom mu\u017ea\nJanuary 30, 2026\nFarbanje jaja sodom bikarbonom: Za 10 minuta oboji\u0107ete i do 50...\nApril 5, 2025\nRekla mi je da sam samo \u201egost\u201c u vlastitoj ku\u0107i \u2014...\nNovember 3, 2025\nOVA BILJKA JE INFUZIJA \u017dIVOTA: Ja\u010da organizam, lije\u010di upalu plu\u0107a, podsti\u010de...\nMarch 7, 2025\nSve\u0161tenik otkriva koji uslov mora da se ispo\u0161tuje da bi se...\nMay 26, 2025\nLoad more\nIzdvojeno\nNovo\nProdala trosoban stan, pa se uselila u kombi od kojeg je...\nNovo\nAdrijana je prvo dete rodila u 66. godini pa zavr\u0161ila na...\nNovo\nTe\u0161ke emocije: \u017dao nam je, ali u narednih par dana ovi...\nNovo\nBila je velika zvezda Jugoslavije, udata za \u010duvenog peva\u010da: Umrla je...\nNovo\nNa\u0161a peva\u010dica odgajana u siroma\u0161tvu, od drugarica pozajmljivala ode\u0107u: Zaradila vi\u0161e...\nNovo\nLo\u0161 zadah mo\u017ee biti uzrok opasnih zdravstvenih problema: Dr Peri\u0161i\u0107 isti\u010de...\nABOUT US\nDobrodo\u0161li na na\u0161 blog. \u017delimo da u\u017eivate u zanimljivom i inspirativnom sadr\u017eaju za sve prilike. Za vas, svakodnevno donosimo zanimljive i korisne informacije iz svijeta i regiona, razli\u010ditih tema od politike do viralnih stvari iz cijelog svijeta.\nContact us: <EMAIL_14>\nFOLLOW US\nPo\u010detna\nO nama\nKontakt\nPravila i uslovi kori\u0161tenja\nPrivacy policy\n\u00a9 Sva prava pridr\u017eana - 2025. - Preno\u0161enje sadr\u017eaja dozvoljeno u OBAVEZNO navo\u0111enje izvora i backlinka na originalni sadr\u017eaj.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fabd6a20-0345-4027-b447-60986758ddff", "content_hash": "8bbd5c59d86b083e43be7ffaa1625972b6db9c98a1fa75afcbb1342958946399", "created_at": "2026-03-28T05:11:10.516873331Z"}
{"id": "554e57ef-839b-499f-a0be-978c15e657a8", "source": "brain", "text": "Frontiers | Extremophilic Bacterium Halomonas desertis G11 as a Cell Factory for Poly-3-Hydroxybutyrate-co-3-Hydroxyvalerate Copolymer\u2019s Production\n\nFrontiers | Extremophilic Bacterium Halomonas desertis G11 as a Cell Factory for Poly-3-Hydroxybutyrate-co-3-Hydroxyvalerate Copolymer\u2019s Production\nFrontiers in Bioengineering and Biotechnology\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nSearch\nFrontiers in Bioengineering and Biotechnology\nSections\nSections\nBiofabrication\nBiomaterials\nBiomechanics\nBioprocess Engineering\nBiosafety and Biosecurity\nBiosensors and Biomolecular Electronics\nCell and Gene Therapy\nIndustrial Biotechnology\nNanobiotechnology\nOrganoids and Organ-On-A-Chip\nSynthetic Biology\nTissue Engineering and Regenerative Medicine\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nFrontiers in Bioengineering and Biotechnology\nSections\nSections\nBiofabrication\nBiomaterials\nBiomechanics\nBioprocess Engineering\nBiosafety and Biosecurity\nBiosensors and Biomolecular Electronics\nCell and Gene Therapy\nIndustrial Biotechnology\nNanobiotechnology\nOrganoids and Organ-On-A-Chip\nSynthetic Biology\nTissue Engineering and Regenerative Medicine\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nFrontiers in Bioengineering and Biotechnology\nSections\nSections\nBiofabrication\nBiomaterials\nBiomechanics\nBioprocess Engineering\nBiosafety and Biosecurity\nBiosensors and Biomolecular Electronics\nCell and Gene Therapy\nIndustrial Biotechnology\nNanobiotechnology\nOrganoids and Organ-On-A-Chip\nSynthetic Biology\nTissue Engineering and Regenerative Medicine\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nSubmit your researchSearch\nYour new experience awaits. Try the new design now and help us make it even better\nSwitch to the new experience\nORIGINAL RESEARCH article\nFront. Bioeng. Biotechnol., 23 May 2022\nSec. Bioprocess Engineering\nVolume 10 - 2022 | https://doi.org/10.3389/fbioe.2022.878843\nThis article is part of the Research TopicCurrent Challenges in Biodegradable Polyhydroxyalkanoates: From The Cradle To The GraveView all 7 articles\nExtremophilic Bacterium Halomonas desertis G11 as a Cell Factory for Poly-3-Hydroxybutyrate-co-3-Hydroxyvalerate Copolymer\u2019s Production\nKhouloud Hammami1 Yasmine Souissi1,2 Amal Souii1 Awatef Ouertani1 Darine El-Hidri1 Marwa Jabberi1 Habib Chouchane1 Amor Mosbah1 Ahmed Slaheddine Masmoudi1 Ameur Cherif1 Mohamed Neifar1,3*\n1BVBGR-LR11ES31, Higher Institute of Biotechnology of Sidi Thabet (ISBST), University of Manouba, Ariana, Tunisia\n2Department of Engineering, German University of Technology in Oman, Muscat, Oman\n3APVA-LR16ES20, National School of Engineers of Sfax (ENIS), University of Sfax, Sfax, Tunisia\nMicrobial polyhydroxyalkanoates (PHA) are biodegradable and biocompatible bio-based polyesters, which are used in various applications including packaging, medical and coating materials. In this study, an extremophilic hydrocarbonoclastic bacterium, previously isolated from saline sediment in the Tunisian desert, has been investigated for PHA production. The accumulation of intracellular PHA granules in Halomonas desertis G11 was detected by Nile blue A staining of the colonies. To achieve maximum PHA yield by the strain G11, the culture conditions were optimized through response surface methodology (RSM) employing a Box-Behnken Design (BBD) with three independent variables, namely, substrate concentration (1\u20135%), inoculum size (1\u20135%) and incubation time (5\u201315 days). Under optimized conditions, G11 strain produced 1.5 g/L (68% of DCW) of PHA using glycerol as a substrate. Application of NMR (1H and 13C) and FTIR spectroscopies showed that H. desertis accumulated PHA is a poly-3-hydroxybutyrate-co-3-hydroxyvalerate (PHBV). The genome analysis revealed the presence of typical structural genes involved in PHBV metabolism including phaA, phaB, phaC, phaP, phaZ, and phaR, coding for acetyl-CoA acetyltransferase, acetoacetyl-CoA reductase, class I polyhydroxyalkanoates synthases, phasin, polyhydroxyalkanoates depolymerase and polyhydroxyalkanoates synthesis repressor, respectively. Glycerol can be metabolized to 1) acetyl-CoA through the glycolysis pathway and subsequently converted to the 3HB monomer, and 2) to propionyl-CoA via the threonine biosynthetic pathway and subsequently converted to the 3HV monomer. In silico analysis of PhaC1 from H. desertis G11 indicated that this enzyme belongs to Class I PHA synthase family with a \u201clipase box\u201d-like sequence (SYCVG). All these characteristics make the extremophilic bacterium H. desertis G11 a promising cell factory for the conversion of bio-renewable glycerol to high-value PHBV.\nIntroduction\nFossil fuel-based plastics play a crucial role in modern lifestyle (Chae and An, 2018). Approximately 400 million tons of plastic were produced globally in 2018. More than 10 million metric tons of plastic ended up into the oceans during 2018 alone. An estimated 13 billion tons of plastic waste will reach the environment by 2050 in the absence of any improvements in current plastic waste management practices (Shams et al., 2021). Synthetic plastics have significant negative impacts on ecosystems, biota, environment, economy, and human health (Sharma and Chatterjee, 2017). As a result, there is a growing demand for bioplastics such as polyhydroxyalkanoates (PHA), polylactic acid, biopolyamide, biopolyethylene and biopolypropylene that provide new solutions in terms of life cycle and raw materials (Akinwumi et al., 2019). The conversion of biowastes to PHAs is considered as a possible eco-friendly alternative to petro-plastics and are currently gaining a lot of interest in the field of industrial applications and waste management (Kourmentza et al., 2017; Patel et al., 2021). Global bioplastic production has increased from 2.1 metric tons in 2020 to about 2.4 metric tons in 2022 (Dubey and Mishra, 2021) and the market opportunity for PHA bioplastic could reach US$100 million by 2024 (Surendran et al., 2020).\nPHA are linear polyesters that consist of hydroxy fatty acids and are synthesized by a wide range of different Gram-positive and Gram-negative bacteria, as well as in some haloarchaeal species (Bugnicourt et al., 2014; Han et al., 2015; Kalia et al., 2021). Among the PHA producing microorganisms, the most-studied were Pseudomonas oleovorans, P. aeruginosa and P. putida, Bacillus megaterium, B. cere", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/554e57ef-839b-499f-a0be-978c15e657a8", "content_hash": "f81f42a30b73df732c024ef09806ef250e5314fe41e8641b504f88a4827969bc", "created_at": "2026-03-28T05:11:10.508957376Z"}
{"id": "4a508496-08cc-4488-8307-0a2587511775", "source": "brain", "text": "Frontiers | A study on land compactness of urban agglomeration-example from Beijing-Tianjin-Hebei\n\nFrontiers | A study on land compactness of urban agglomeration-example from Beijing-Tianjin-Hebei\nFrontiers in Environmental Science\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nSearch\nFrontiers in Environmental Science\nSections\nSections\nAtmosphere and Climate\nBiogeochemical Dynamics\nDrylands\nEcosystem Restoration\nEnvironmental Citizen Science\nEnvironmental Economics and Management\nEnvironmental Informatics and Remote Sensing\nEnvironmental Policy and Governance\nEnvironmental Systems Engineering\nFreshwater Science\nInterdisciplinary Climate Studies\nLand Use Dynamics\nSocial-Ecological Urban Systems\nSoil Processes\nToxicology, Pollution and the Environment\nWater and Wastewater Management\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nFrontiers in Environmental Science\nSections\nSections\nAtmosphere and Climate\nBiogeochemical Dynamics\nDrylands\nEcosystem Restoration\nEnvironmental Citizen Science\nEnvironmental Economics and Management\nEnvironmental Informatics and Remote Sensing\nEnvironmental Policy and Governance\nEnvironmental Systems Engineering\nFreshwater Science\nInterdisciplinary Climate Studies\nLand Use Dynamics\nSocial-Ecological Urban Systems\nSoil Processes\nToxicology, Pollution and the Environment\nWater and Wastewater Management\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nFrontiers in Environmental Science\nSections\nSections\nAtmosphere and Climate\nBiogeochemical Dynamics\nDrylands\nEcosystem Restoration\nEnvironmental Citizen Science\nEnvironmental Economics and Management\nEnvironmental Informatics and Remote Sensing\nEnvironmental Policy and Governance\nEnvironmental Systems Engineering\nFreshwater Science\nInterdisciplinary Climate Studies\nLand Use Dynamics\nSocial-Ecological Urban Systems\nSoil Processes\nToxicology, Pollution and the Environment\nWater and Wastewater Management\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nSubmit your researchSearch\nYour new experience awaits. Try the new design now and help us make it even better\nSwitch to the new experience\nORIGINAL RESEARCH article\nFront. Environ. Sci., 19 August 2022\nSec. Land Use Dynamics\nVolume 10 - 2022 | https://doi.org/10.3389/fenvs.2022.969562\nThis article is part of the Research TopicLand Governance, Integrated Socio-Ecosystem and Sustainable DevelopmentView all 33 articles\nA study on land compactness of urban agglomeration-example from Beijing-Tianjin-Hebei\nHuiying Wang1 Huimin Wang2* Xuehan Xiong3\n1School of Government, University of International Business and Economics, Beijing, China\n2Department of Aviation Economics and Management, Beijing Institute of Economics and Management, Beijing, China\n3Development Holdings Co., Ltd., Hainan, China\nCompactness, intensity, efficiency and greenness are becoming the goals of regional governance in China. This study, based on the compact development theory, takes the urban agglomeration of Jingjinji as the research object, uses the composite index to construct a compactness index system based on production-living-ecological space and adopts entropy method to measure and analyze the degree of compactness. The results show that there is an obvious internal differentiation in Jingjinji, and the overall situation is not compact. Composed of production, living and ecological spaces, the compactness of the territorial space differs significantly. Production space is of the highest degree compactness, followed by living space and the lowest is ecological space. By comparing each index, compactness degrees of economic factors and municipal production facilities are better than those of the production land and transportation. Compactness degrees of Social factors of living space are more developed than those of residential land and public services. The overall compactness degree of the ecological space is the lowest, but the degrees of compactness are relatively balanced and there are small differences. The compactness degree of the green land is slightly lower than that of pollution treatment.\n1 Introduction\nStarting from \u201c14th Five-Year Plan\u201d, China focused on the overall and systematic governance of the entire territorial space, classified into production, living and ecological spaces (PLES). Meanwhile, the urban agglomeration has become the main geographical unit and spatial development pattern in China due to significant aggregation of population and economic functions. However, the main problem has been that regional development is unbalanced, uncoordinated and incompact in some urban agglomerations, especially in the Beijing-Tianjin-Hebei region (also known as Jingjinji).\nFrom the perspective of PLES in the urban agglomeration of Jingjinji, the development of production space is seriously differentiated, and high efficiency has not yet been achieved in every city. The provision of living space is not diverse and abundant, so high-quality development has not yet been achieved. In addition, the ecological space is not adequately protected by the Regulations for the Implementation of the Land Administration Law, the policy that should scientifically control territorial planning.\nAbove all, a series of economic, social and ecological problems still exist in the Jingjinji urban agglomeration. Therefore, how to formulate a governance plan in accordance with local conditions and promote heterogeneous regions to exploit comparative advantages and achieve highly efficient and qualified development, has become an inherent requirement for the Jingjinji urban agglomeration in order to further optimize territorial space.\n2 Literature review\nIn the context of spatial governance and planning, academic research on land governance has also achieved new progress. Since the conservation and use of land resources is one of the important goals of spatial governance, the compact development theory related to urban development has been gradually adopted in spatial governance research. The compact development theory originates from the \u201ccompact city\u201d proposed by European and American countries to achieve sustainable development.\nDanziger and Satty 1973) were the first to present the compact city theory in the context of achieving sustainable development (Dantizing and Satty, 1973). They believed that a compact ci", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/4a508496-08cc-4488-8307-0a2587511775", "content_hash": "f6871a24eb02b88b82eb8114fe5ba99a380bfd6f36ec8a183a962f4a264f8f93", "created_at": "2026-03-28T05:11:10.416776086Z"}
{"id": "11d3de36-447d-4638-99c7-87604eae1d78", "source": "brain", "text": "Contributor: Spisak, Shelley (Editor) - Reports of the Surgeon General - Profiles in Science Search Results\n\nContributor: Spisak, Shelley (Editor) - Reports of the Surgeon General - Profiles in Science Search Results\nSkip to search Skip to main content Skip to first result\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nContact\nAbout\nReports of the Surgeon General\nHome\nThe Story\nBrief History\nChanging Conceptions of Public Health\nThe 1964 Report on Smoking and Health\nSecondary Smoking, Individual Rights, and Public Space\nThe AIDS Epidemic\nPublic Health and Disease Prevention\nReports of the Surgeon General after 2000\nCollection Items\nsearch for\nSearch\nHome\nSearch results\nSearch\nSearch Constraints\nStart Over You searched for: Contributor Spisak, Shelley (Editor) Remove constraint Contributor: Spisak, Shelley (Editor)\n1 - 8 of 8\nSort by Title (Z-A)\nRelevance Title (A-Z) Title (Z-A) Date (oldest to newest) Date (newest to oldest)\nNumber of results to display per page\n50 per page per page\n10 per page 20 per page 50 per page 100 per page\nView results as:\nList Gallery Masonry Slideshow\nSearch Results\n1. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (pages 76-100)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n2. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (pages 51-75)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n3. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (pages 26-50)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n4. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (pages 101-116)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n5. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (pages 1-25)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n6. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (Title Page and Introductory Material)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n7. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation (Index)\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nExcerpts\nWorkshops (seminars)\n8. Second Followup Report: The Surgeon General's Workshop on Breastfeeding and Human Lactation\nCreator:\nNational Center for Education in Maternal and Child Health (U.S.)\nUnited States. Public Health Service. Health Resources and Services Administration. Maternal and Child Health Bureau\nUnited States. Public Health Service. Office of the Surgeon General\nDate:\n1991\nPublisher:\nNational Center for Education in Maternal and Child Health (U.S.)\nGenre:\nOfficial reports\nWorkshops (seminars)\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/11d3de36-447d-4638-99c7-87604eae1d78", "content_hash": "5883a5283c1e56f6702f4c1e4399c806243b3435b457fd91381219b141cea04b", "created_at": "2026-03-28T05:11:10.402492096Z"}
{"id": "faf9d260-7bac-4735-a3ae-151194d68d5e", "source": "brain", "text": "C\u00e1ncer de mama - M\u00e9dicos y departamentos - Mayo Clinic\n\nC\u00e1ncer de mama - M\u00e9dicos y departamentos - Mayo Clinic\nEste contenido no tiene una versi\u00f3n en ingl\u00e9s\nEste contenido no tiene una versi\u00f3n en \u00e1rabe\nSkip to content\nAtenci\u00f3n m\u00e9dica en Mayo Clinic\nAtenci\u00f3n m\u00e9dica centrada en el paciente\nInformaci\u00f3n sobre Mayo Clinic\nPedir una cita\nEncuentra un m\u00e9dico\nUbicaciones\nEnsayos cl\u00ednicos\nCon\u00e9ctate con grupos de apoyo\nGu\u00eda para el paciente y las visitas\nFacturaci\u00f3n y seguro m\u00e9dico\nDepartamentos y centros m\u00e9dicos\nServicios Internacionales\nComun\u00edcate con nosotros\nGu\u00eda para el paciente y las visitas\nBiblioteca de la Salud\nEnfermedades y afecciones\nS\u00edntomas\nAn\u00e1lisis y procedimientos\nMedicamentos y suplementos\nEstilo de vida saludable\nBolet\u00edn sobre salud y libros de Mayo Clinic\nBolet\u00edn sobre salud y libros de Mayo Clinic\nPara profesionales m\u00e9dicos\nRecursos para profesionales m\u00e9dicos\nPara remitir a un paciente\nEducaci\u00f3n M\u00e9dica Continua\nLaboratorios de Mayo Clinic\nCentro de videos\nRevistas y publicaciones\nAsociaci\u00f3n de Exalumnos de Mayo Clinic\nEducaci\u00f3n M\u00e9dica Continua\nInvestigaci\u00f3n y educaci\u00f3n en Mayo Clinic\nInvestigaci\u00f3n\nInvestigaci\u00f3n en Mayo Clinic\nProfesores de investigaci\u00f3n\nLaboratorios\nInstalaciones centrales\nCentros y programas\nDepartamentos y divisiones\nEnsayos cl\u00ednicos\nJunta de Revisi\u00f3n Institucional\nFellowships posdoctorales\nProgramas subvencionados para capacitaci\u00f3n\nEducaci\u00f3n\nFacultad de Medicina y Ciencias de Mayo Clinic\nEscuela de Posgrado en Ciencias Biom\u00e9dicas en Mayo Clinic\nEscuela de Medicina Alix en Mayo Clinic\nEscuela para Educaci\u00f3n M\u00e9dica de Posgrado en Mayo Clinic\nEscuela de Ciencias de la Salud en Mayo Clinic\nEscuela para Desarrollo Profesional Continuo en Mayo Clinic\nFacultad de Medicina y Ciencias de Mayo Clinic\nPedir una cita\nPara donar\nIniciar la sesi\u00f3n\nBuscar\nMen\u00fa\nPedir una cita\nPara donar\nEnfermedades y condiciones\nEncontrar una doctora\nAtenci\u00f3n m\u00e9dica en Mayo Clinic\nAtenci\u00f3n m\u00e9dica centrada en el paciente\nInformaci\u00f3n sobre Mayo Clinic\nPedir una cita\nEncuentra un m\u00e9dico\nUbicaciones\nEnsayos cl\u00ednicos\nCon\u00e9ctate con grupos de apoyo\nGu\u00eda para el paciente y las visitas\nFacturaci\u00f3n y seguro m\u00e9dico\nDepartamentos y centros m\u00e9dicos\nServicios Internacionales\nComun\u00edcate con nosotros\nGu\u00eda para el paciente y las visitas\nBiblioteca de la Salud\nEnfermedades y afecciones\nS\u00edntomas\nAn\u00e1lisis y procedimientos\nMedicamentos y suplementos\nEstilo de vida saludable\nBolet\u00edn sobre salud y libros de Mayo Clinic\nBolet\u00edn sobre salud y libros de Mayo Clinic\nPara profesionales m\u00e9dicos\nRecursos para profesionales m\u00e9dicos\nPara remitir a un paciente\nEducaci\u00f3n M\u00e9dica Continua\nLaboratorios de Mayo Clinic\nCentro de videos\nRevistas y publicaciones\nAsociaci\u00f3n de Exalumnos de Mayo Clinic\nEducaci\u00f3n m\u00e9dica continua\nInvestigaci\u00f3n y educaci\u00f3n en Mayo Clinic\nInvestigaci\u00f3n\nInvestigaci\u00f3n en Mayo Clinic\nProfesores de investigaci\u00f3n\nLaboratorios\nInstalaciones centrales\nCentros y programas\nDepartamentos y divisiones\nEnsayos cl\u00ednicos\nJunta de Revisi\u00f3n Institucional\nFellowships posdoctorales\nProgramas subvencionados para capacitaci\u00f3n\nEducaci\u00f3n\nFacultad de Medicina y Ciencias de Mayo Clinic\nEscuela de Posgrado en Ciencias Biom\u00e9dicas en Mayo Clinic\nEscuela de Medicina Alix en Mayo Clinic\nEscuela para Educaci\u00f3n M\u00e9dica de Posgrado en Mayo Clinic\nEscuela de Ciencias de la Salud en Mayo Clinic\nEscuela para Desarrollo Profesional Continuo en Mayo Clinic\nFacultad de Medicina y Ciencias de Mayo Clinic\nDonaciones a Mayo Clinic\nPara donar\nDonaciones a Mayo Clinic\nPreguntas frecuentes\nCont\u00e1ctenos para hacer una donaci\u00f3n\nPara donar\nEnfermedades y afecciones\nC\u00e1ncer de mama\nSolicite una Consulta\nS\u00edntomas y\ncausas\nDiagn\u00f3stico y\ntratamiento\nM\u00e9dicos y\ndepartamentos\nAtenci\u00f3n en\nMayo Clinic\nImprimir\nDepartamentos y especialidades\nMayo Clinic tiene uno de los centros m\u00e9dicos m\u00e1s grandes y experimentados en los Estados Unidos, con sedes en Arizona, Florida y Minnesota. El personal, que est\u00e1 capacitado en muchas especialidades, trabaja en conjunto para garantizar una atenci\u00f3n de calidad y una recuperaci\u00f3n exitosa.\nDepartamentos donde se trata este trastorno\nAtenci\u00f3n oncol\u00f3gica en Mayo Clinic\nCirug\u00eda\nCirug\u00eda pl\u00e1stica\nCl\u00ednicas para Sobrevivientes al C\u00e1ncer\nCl\u00ednica de las mamas\nCl\u00ednica de Mamas de Alto Riesgo\nHematolog\u00eda y oncolog\u00eda pedi\u00e1trica\nOncolog\u00eda (m\u00e9dica)\nOncolog\u00eda integrativa\nOncolog\u00eda Quir\u00fargica de Mama y Melanoma de Rochester\nOncolog\u00eda quir\u00fargica y cirug\u00eda endocrina en Arizona\nOncolog\u00eda radioter\u00e1pica\nPrograma de c\u00e1ncer hereditario\nPrograma de Cirug\u00eda para el C\u00e1ncer de Mama en Jacksonville\nPrograma de terapia con rayos de protones\nRadiolog\u00eda\nSalud de la mujer\n\u00c1reas donde se investiga este trastorno\nRadiology Research\nM\u00e9dicos que tratan esta enfermedad\neditar los filtros de b\u00fasqueda\ncerca\nLimitar la b\u00fasqueda\nPor ubicaci\u00f3n\nRochester, MN\nJacksonville, FL\nPhoenix/Scottsdale, AZ\nPor apellido\nBuscar un m\u00e9dico cuyo apellido comience con una letra A A\nBuscar un m\u00e9dico cuyo apellido comience con una letra B B\nactivo Buscar un m\u00e9dico cuyo apellido comience con una letra C C\nBuscar un m\u00e9dico cuyo apellido comience con una letra D D\nBuscar un m\u00e9dico cuyo apellido comience con una letra E E\nNo hay ning\u00fan m\u00e9dico cuyo apellido comience con dicha letra F F\nBuscar un m\u00e9dico cuyo apellido comience con una letra G G\nBuscar un m\u00e9dico cuyo apellido comience con una letra H H\nBuscar un m\u00e9dico cuyo apellido comience con una letra I I\nBuscar un m\u00e9dico cuyo apellido comience con una letra J J\nBuscar un m\u00e9dico cuyo apellido comience con una letra K K\nBuscar un m\u00e9dico cuyo apellido comience con una letra L L\nBuscar un m\u00e9dico cuyo apellido comience con una letra M M\nBuscar un m\u00e9dico cuyo apellido comience con una letra N N\nBuscar un m\u00e9dico cuyo apellido comience con una letra O O\nBuscar un m\u00e9dico cuyo apellido comience con una letra P P\nNo hay ning\u00fan m\u00e9dico cuyo apellido comience con dicha letra Q Q\nBuscar un m\u00e9dico cuyo apellido comience con una letra R R\nBuscar un m\u00e9dico cuyo apellido comience con una letra S S\nBuscar un m\u00e9dico cuyo apellido comience con una letra T T\nNo hay ning\u00fan m\u00e9dico cuyo apellido comience con dicha letra U U\nBuscar un m\u00e9dico cuyo apellido comience con una letra V V\nBuscar un m\u00e9dico cuyo apellido comience con una letra W W\nNo hay ning\u00fan m\u00e9dico cuyo apellido comience con dicha letra X X\nBuscar un m\u00e9dico cuyo apellido comience con una letra Y Y\nNo hay ning\u00fan m\u00e9dico cuyo apellido comience con dicha letra Z Z\nRestablecer todos los filtros\nConsejos para la b\u00fasqueda\nUsar comillas para las frases.\nHaz clic en para buscar aunque no haya sugerencias autom\u00e1ticas dentro del campo de b\u00fasqueda, ya que igual podr\u00edas obtener resultados.\nMostrando 1-7 de doctores disponibles\nInicial del apellido: C\nJose A. Castro Garcia, M.D.\ncirujano pl\u00e1stico\nRochester, MN\n\u00c1reas de desarrollo:\nReconstrucci\u00f3n de los senos con implantes , Cirug\u00eda reconstructiva, Reparaci\u00f3n de fractura facial, Transferencia de tej...ido adiposo, Cirug\u00eda pl\u00e1stica de los senos, cirug\u00eda de feminizaci\u00f3n facial, cirug\u00eda para reasignaci\u00f3n de sexo, Reconstrucci\u00f3n de los senos, Cirug\u00eda microvascular, reconstrucci\u00f3n facial , cirug\u00eda oncopl\u00e1stica conservadora de mamas, colgajo libre, reconstrucci\u00f3n de la pared abdominal, Cuidado de la herida, reparaci\u00f3n de f\u00edstula rectovaginal, Cambio del implante mamario, reconstrucci\u00f3n microvascular , Cirug\u00eda de mama, Cirug\u00eda con colgajo, C\u00e1ncer de mama, angiosarcoma de mama, Nariz quebrada, F\u00edstula rectovaginal, Fractura, mand\u00edbula quebrada, Fractura orbital, laceraci\u00f3n facial, fractura facial, Herida, lesi\u00f3n facial\nMostrar m\u00e1s \u00e1reas de especializaci\u00f3n para Jose A. Castro Garcia, M.D.\nElizabeth J. Cathcart-Rake, M.D.\nonc\u00f3logo\nRochester, MN\n\u00c1reas de desarrollo:\nC\u00e1ncer de mama\nGrace M. Choong, M.D.\nonc\u00f3logo\nginec\u00f3logo onc\u00f3logo\nRochester, MN\n\u00c1reas de desarrollo:\nC\u00e1ncer de mama, C\u00e1ncer ginecol\u00f3gico\nSaranya Chumsri, M.D.\nonc\u00f3logo\nJacksonville, FL\n\u00c1reas de desarrollo:\nterapia de c\u00e9lulas T con receptores de ant\u00edgenos quim\u00e9ricos , C\u00e1ncer de mama\nGerardo Colon-Otero, M.D.\ninternista\nonc\u00f3logo\nhemat\u00f3logo\nJacksonville, FL\n\u00c1reas de desarrollo:\nTrasplante de c\u00e9lulas madre, C\u00e1ncer, C\u00e1ncer de mama, C\u00e1ncer ", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/faf9d260-7bac-4735-a3ae-151194d68d5e", "content_hash": "ccce22abfbd816623c58c91cacb7f9584f67498bb93bdce27e5a3577843dc0e1", "created_at": "2026-03-28T05:11:10.395039648Z"}
{"id": "d4e6adf5-52bf-40a0-a58e-c562ba7f1d1c", "source": "brain", "text": "NIH VideoCast - IIG Seminar - Multimodal decoding of liver regeneration and repair\n\nNIH VideoCast - IIG Seminar - Multimodal decoding of liver regeneration and repair\nSkip Navigation\nAn official website of the United States government\nHere\u2019s how you know\nHere\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nNIH VideoCasting\nCIT can broadcast your seminar, conference or meeting live to a world-wide audience over the Internet as a real-time streaming video. The event can be recorded and made available for viewers to watch at their convenience as an on-demand video or a downloadable file. CIT can also broadcast NIH-only or HHS-only content.\nVideoCast Home\nPast Events\nUpcoming Events\nFAQ\nContact Us\nTest Computer\nSearch\nhttps://uccwow2.cit.nih.gov/vod\nThis Videocast has been designated HHS Only. You are not authorized to view this event from this network.\nPlease refer to this FAQ: NIH and HHS only events\nVideoCast Send Live Feedback\n\u00d7\nIIG Seminar - Multimodal decoding of liver regeneration and repair\nYour name\nEmail Address\nMessage\nSend Message\nCancel", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/d4e6adf5-52bf-40a0-a58e-c562ba7f1d1c", "content_hash": "347bf153b0170c6cee14b33652859ebaf82edc30549b26bf5be3e8464f9b416b", "created_at": "2026-03-28T05:11:10.394972379Z"}
{"id": "12153902-c232-4685-bc70-fd122c93b729", "source": "brain", "text": "Kansas City \u2013 Creative By Nature\n\nKansas City \u2013 Creative By Nature\nSkip to content\nCreative By Nature\nDanny C Boyce \u2013 Photographic Artistry\nMenu Menu\nHome\nJim Stukey\nUpdates\nOpen search bar\nSearch for:\nClose search bar\nTag: Kansas City\nObservation\nDecember 3, 2025 December 18, 2025\nby Danny\nLooking out at Kansas City, Missouri. When you took a train to get places, you came to the station.\nTo me, photography is an art of observation. It\u2019s about finding something interesting in an ordinary place\u2026\nI\u2019ve found it has little to do with the things you see and everything to do with the way you see them.\n\u2013 Elliott Erwitt\nKarl Lagerfeld on Photography\nOctober 8, 2025 October 10, 2025\nby Danny\nKansas City, Missouri Arts and Science Museum.\nIt\u2019s inside the renewed, and repurposed, KC Railway Station\n\u201cWhat I like about photographs is that they capture a moment that\u2019s gone forever, impossible to reproduce.\u201d\n\u2013 Karl Lagerfeld\nSearch\nSearch\nRecent Posts\nSecret Secrets\nWhat is Photography?\nPhotogravity\nGood Photographs\nThe Power of Image\nRecent Comments\nNo comments to show.\nArchives\nFebruary 2026\nJanuary 2026\nDecember 2025\nNovember 2025\nOctober 2025\nSeptember 2025\nFebruary 2025\nCategories\nPhotographic Artistry\nCopyright \u00a9 2026 Creative By NatureTheme by SiteOrigin\nScroll to top", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/12153902-c232-4685-bc70-fd122c93b729", "content_hash": "18d437bf07d4f3ac0824cd6cd54bba2932582f96c3d296d07c0005f0d251f039", "created_at": "2026-03-28T05:11:10.237211404Z"}
{"id": "357a2044-d610-45ed-8e3f-5b400cb0db78", "source": "brain", "text": "Frontiers | FEV Maintains Homing and Expansion by Activating ITGA4 Transcription in Primary and Relapsed AML\n\nFrontiers | FEV Maintains Homing and Expansion by Activating ITGA4 Transcription in Primary and Relapsed AML\nFrontiers in Oncology\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nSearch\nFrontiers in Oncology\nSections\nSections\nBreast Cancer\nCancer Cell Signaling\nCancer Epidemiology and Prevention\nCancer Genetics\nCancer Imaging and Image-directed Interventions\nCancer Immunity and Immunotherapy\nCancer Metabolism\nCancer Molecular Targets and Therapeutics\nCardio-Oncology\nGastrointestinal Cancers: Colorectal Cancer\nGastrointestinal Cancers: Gastric and Esophageal Cancers\nGastrointestinal Cancers: Hepato Pancreatic Biliary Cancers\nGenitourinary Oncology\nGynecological Oncology\nHead and Neck Cancer\nHematologic Malignancies\nMolecular and Cellular Oncology\nNeuro-Oncology and Neurosurgical Oncology\nPediatric Oncology\nPharmacology of Anti-Cancer Drugs\nRadiation Oncology\nSkin Cancer\nSurgical Oncology\nThoracic Oncology\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nAbout us\nAbout us\nWho we are\nMission and values\nHistory\nLeadership\nAwards\nImpact and progress\nFrontiers' impact\nOur annual reports\nThought leadership\nPublishing model\nHow we publish\nOpen access\nPeer review\nResearch integrity\nResearch Topics\nFAIR\u00b2 Data Management\nFee policy\nServices\nSocieties\nNational consortia\nInstitutional partnerships\nCollaborators\nMore from Frontiers\nFrontiers Forum\nFrontiers Planet Prize\nPress office\nSustainability\nCareer opportunities\nContact us\nAll journalsAll articlesSubmit your research\nFrontiers in Oncology\nSections\nSections\nBreast Cancer\nCancer Cell Signaling\nCancer Epidemiology and Prevention\nCancer Genetics\nCancer Imaging and Image-directed Interventions\nCancer Immunity and Immunotherapy\nCancer Metabolism\nCancer Molecular Targets and Therapeutics\nCardio-Oncology\nGastrointestinal Cancers: Colorectal Cancer\nGastrointestinal Cancers: Gastric and Esophageal Cancers\nGastrointestinal Cancers: Hepato Pancreatic Biliary Cancers\nGenitourinary Oncology\nGynecological Oncology\nHead and Neck Cancer\nHematologic Malignancies\nMolecular and Cellular Oncology\nNeuro-Oncology and Neurosurgical Oncology\nPediatric Oncology\nPharmacology of Anti-Cancer Drugs\nRadiation Oncology\nSkin Cancer\nSurgical Oncology\nThoracic Oncology\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nFrontiers in Oncology\nSections\nSections\nBreast Cancer\nCancer Cell Signaling\nCancer Epidemiology and Prevention\nCancer Genetics\nCancer Imaging and Image-directed Interventions\nCancer Immunity and Immunotherapy\nCancer Metabolism\nCancer Molecular Targets and Therapeutics\nCardio-Oncology\nGastrointestinal Cancers: Colorectal Cancer\nGastrointestinal Cancers: Gastric and Esophageal Cancers\nGastrointestinal Cancers: Hepato Pancreatic Biliary Cancers\nGenitourinary Oncology\nGynecological Oncology\nHead and Neck Cancer\nHematologic Malignancies\nMolecular and Cellular Oncology\nNeuro-Oncology and Neurosurgical Oncology\nPediatric Oncology\nPharmacology of Anti-Cancer Drugs\nRadiation Oncology\nSkin Cancer\nSurgical Oncology\nThoracic Oncology\nArticlesResearch TopicsEditorial board\nAbout journal\nAbout journal\nScope\nField chief editors\nMission & scope\nFacts\nJournal sections\nOpen access statement\nCopyright statement\nQuality\nFor authors\nWhy submit?\nArticle types\nAuthor guidelines\nEditor guidelines\nPublishing fees\nSubmission checklist\nContact editorial office\nSubmit your researchSearch\nYour new experience awaits. Try the new design now and help us make it even better\nSwitch to the new experience\nORIGINAL RESEARCH article\nFront. Oncol., 07 July 2022\nSec. Hematologic Malignancies\nVolume 12 - 2022 | https://doi.org/10.3389/fonc.2022.890346\nThis article is part of the Research TopicNew Emerging Functions of Transcription Factors and RNA-Binding Proteins in the Development of Hematological MalignanciesView all 7 articles\nFEV Maintains Homing and Expansion by Activating ITGA4 Transcription in Primary and Relapsed AML\nJubin Zhang1,2\u2020 Lijuan Qi1,2\u2020 Tanzhen Wang1,2\u2020 Jingnan An1,2 Biqi Zhou1,2 Yanglan Fang1,2 Yujie Liu1,2 Meng Shan1,2 Dengli Hong3 Depei Wu1,2* Yang Xu1,2* Tianhui Liu1,2*\n1National Clinical Research Center for Hematologic Diseases, Jiangsu Institute of Hematology, The First Affiliated Hospital of Soochow University, Suzhou, China\n2Institute of Blood and Marrow Transplantation, Collaborative Innovation Center of Hematology, Soochow University, Suzhou, China\n3Key Laboratory of Cell Differentiation and Apoptosis of Ministry of Education, Department of Pathophysiology, Shanghai Jiao Tong University School of Medicine (SJTU-SM), Shanghai, China\nAcute myeloid leukemia (AML) is an aggressive hematological malignancy that recurs in approximately 50% of cases. Elevated homing and uncontrolled expansion are characteristics of AML cells. Here, we identified that Fifth Ewing Variant (FEV) regulates the homing and expansion of AML cells. We found that FEV was re-expressed in 30% of primary AML samples and in almost all relapsed AML samples, and FEV expression levels were significantly higher in relapsed samples compared to primary samples. Interference of FEV expression in AML cell lines delayed leukemic progression and suppressed homing and proliferation. Moreover, FEV directly activated integrin subunit alpha 4 (ITGA4) transcription in a dose-dependent manner. Inhibition of integrin \u03b14 activity with natalizumab (NZM) reduced the migration and colony-forming abilities of blasts and leukemic-initiating cells (LICs) in both primary and relapsed AML. Thus, our study suggested that FEV maintains the homing and expansion of AML cells by activating ITGA4 transcription and that targeting ITGA4 inhibits the colony-forming and migration capacities of blasts and LICs. Thus, these findings suggested that the FEV-ITGA4 axis may be a therapeutic target for both primary and relapsed AML.\nIntroduction\nAcute myeloid leukemia (AML) is an aggressive hematological malignancy in which immature cells accumulate and expand uncontrollably. Nearly 50% of patients relapse after induction chemotherapy (1, 2). Although new approaches have improved the prognosis of some patients, the majority of primary and relapsed AML patients still lack effective treatment (1\u20134). Therefore, there is an urgent need for novel targets or drugs to improve the outcomes of these patients.\nEnhanced homing and migration abilities are features of AML cells, which rapidly home to bone marrow (BM) and hijack the normal hematopoietic niche to aid extensive expansion of leukemic initiating cells (LICs) (5\u20137). Cell-to-cell or cell-to-matrix interactions mediated by C-X-C Motif Chemokine Receptor 4 (CXCR4)- C-X-C Motif Chemokine Ligand 12 (CXCL12), integrins and CD44 signaling pathways have been reported to contribute to the homing of leukemic cells to the BM microenvironment (5\u201311). However, the upstream mechanism that activates the pathways of VLA-4 remains unknown. Here, we identified that fifth Ewing variant (FEV) regulates integrin signaling.\nFEV (also known as PET1 in mammals) is an E26 transformation-specific transcripti", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/357a2044-d610-45ed-8e3f-5b400cb0db78", "content_hash": "51a7fbf65b718300ed1fa34c0eae9139fe8301a21d592c08ea6174a3d7c6d7a4", "created_at": "2026-03-28T05:11:10.221351264Z"}
{"id": "01f97c30-b090-4858-901a-20d9aeb491e9", "source": "brain", "text": "NLM Support Center \u00b7 NLM Customer Support Center\n\nNLM Support Center \u00b7 NLM Customer Support Center\nYou\u2019re offline. This is a read only version of the page.\nToggle navigation\nNational Library of Medicine\nNational Library of Medicine\nSupport Center Home\nHome\nBrowse Help Topics\nSearch\nMost popular articles\nHow do I obtain the full text of an article?\nHow do I cite NCBI services and databases?\nWhat is a Material Safety Data Sheet (MSDS)?\nWhy do I get error messages when I try to annotate a coding region (CDS) in BankIt?\nWhere can I find information about my health insurance?\nMost recent articles\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nDec 9, 2025\nCan a publisher submit a manuscript to NIHMS for inclusion in PubMed Central on my behalf?\nDec 9, 2025\nWhen will a PMCID be assigned to an NIHMS manuscript?\nOct 8, 2025\nWill a search check my spelling?\nOct 8, 2025\nWhen is required clinical trial results information due?\nTop rated articles\nAug 27, 2025\nWhat are genome assembly accession numbers at NCBI?\nDec 10, 2025\nWhere can I complete the UMLS annual report?\nNov 12, 2019\nHow do I know which Routing Method to use?\nMar 21, 2018\nHow are SNOMED CT files organized?\nNov 20, 2019\nHow do I see the routing history for my Borrow request?\nHealth Literature Drugs & Medical Devices About NLM & NIH My NCBI/Accounts BLAST Submit Data Genes & Genomes ClinicalTrials.gov Getting NLM Data Grants & Funding History of Medicine\nWrite to the help desk\nThe Knowledge Base contains numerous support references, created by our support professionals who have resolved issues for our customers. It is constantly updated, expanded, and refined to ensure that you have access to the very latest information.\n\u200bConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/01f97c30-b090-4858-901a-20d9aeb491e9", "content_hash": "fb1cfe8a4b8f262d7c470e771dd735e46402178ec219bf148d3c1b8d730146ec", "created_at": "2026-03-28T05:11:10.204429109Z"}
{"id": "2ae7cf86-f9eb-4f45-ad30-313f809fc1c5", "source": "brain", "text": "\u6771\u5357\u4e9e\u5730\u5340\u767b\u9769\u71b1\u75ab\u60c5\u56b4\u5cfb\uff0c\u75be\u7ba1\u7f72\u547c\u7c72\u570b\u4eba\u524d\u5f80\u9ad8\u98a8\u96aa\u5730\u5340\u52d9\u5fc5\u505a\u597d\u9632\u868a\u63aa\u65bd - Taiwan Centers for Disease Control\n\n\u6771\u5357\u4e9e\u5730\u5340\u767b\u9769\u71b1\u75ab\u60c5\u56b4\u5cfb\uff0c\u75be\u7ba1\u7f72\u547c\u7c72\u570b\u4eba\u524d\u5f80\u9ad8\u98a8\u96aa\u5730\u5340\u52d9\u5fc5\u505a\u597d\u9632\u868a\u63aa\u65bd - Taiwan Centers for Disease Control\n\"Your browser does not support JavaScript. If the webpage function is not working properly, please enable the browser JavaScript status.\"\nCenter block ALT+C\n\u4e2d\n:::\nHome\n\u4e2d\u6587\u7248\nSitemap\nRSS\nTotal station search\nAbout CDC\nAbout CDC\nPolicies\nNHCC\nActs and Regulations\nPublications\nDiseases & Conditions\nImportant Diseases\nTravelers\u2019 Health\nQuarantine\nTravel Health Notices\nForeigners\u2019 Health\nInfection Control and Biosafety\nVaccine-Preventable Diseases Control\nPrograms & Campaigns\nResearch & Development\nEnd TB Special Project\nPreparedness and Response\nField Epidemiology Training Program\nResearch Reports\nInternship(training) Programs Guidelines\nData & Statistics\nTaiwan National Infectious Disease Statistics System\nStatistics of HIV/AIDS\nDisease Surveillance Express\nInfluenza Express\nNational Notifiable Disease Surveillance Report\nWeekly Report of Enterovirus Infection\nTaiwan Healthcare-associated infection and Antimicrobial resistance Surveillance System\nTaiwan CDC Open Data Portal\nInternational Cooperation\nTaiwan IHR National Focal Point Contact Information\nInternational Cooperation\nInternational Conference\nAPEC Related Events\nForeign Visitors\nRelative Resources\nSchool Visits\nHome\n\u50b3\u67d3\u75c5\u8207\u9632\u75ab\u5c08\u984c\n\u50b3\u67d3\u75c5\u4ecb\u7d39\n\u7b2c\u4e8c\u985e\u6cd5\u5b9a\u50b3\u67d3\u75c5\n\u767b\u9769\u71b1\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u65b0\u805e\u7a3f\n\u767b\u9769\u71b1\n\u767b\u9769\u71b1\n\u75be\u75c5\u4ecb\u7d39\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u6700\u65b0\u6d88\u606f\u53ca\u75ab\u60c5\u8a0a\u606f\n\u65b0\u805e\u7a3f\n\u81f4\u91ab\u754c\u901a\u51fd\n\u767b\u9769\u71b1\u6d41\u884c\u5340(NS1\u5feb\u7be9\u5373\u78ba\u8a3a)\n\u767b\u9769\u71b1\u611f\u67d3\u98a8\u96aa\u570b\u5bb6\n\u767b\u9769\u71b1\u5730\u5716\uff08\u5efa\u8b70\u4f7f\u7528Chrome\u700f\u89bd\u5668\u64cd\u4f5c\uff09\n\u7d71\u8a08\u8cc7\u6599\u67e5\u8a62\n\u570b\u969b\u91cd\u8981\u75ab\u60c5\n\u570b\u969b\u9593\u65c5\u904a\u75ab\u60c5\u5efa\u8b70\u7b49\u7d1a\u8868\n\u75c5\u5a92\u868a\u9ad8\u98a8\u96aa\u5730\u5340\n\u91cd\u8981\u6307\u5f15\u53ca\u6559\u6750\n\u6cbb\u7642\u7167\u8b77\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u75c5\u5a92\u868a\u8cc7\u6599\n\u81fa\u7063\u5730\u5340\u57c3\u53ca\u6591\u868a\u5206\u5e03\u9109\u93ae\u73fe\u6cc1\n\u6591\u868a\u85e5\u6548\u8a66\u9a57\u7d50\u679c\n\u75c5\u5a92\u868a\u5bc6\u5ea6\u8abf\u67e5\n\u5ba3\u5c0e\u7d20\u6750\n\u5ba3\u5c0e\u7d20\u6750\n\u5ba3\u5c0e\u7d20\u6750\n\u591a\u5a92\u9ad4\n\u6d77\u5831\n\u55ae\u5f35\n\u624b\u518a\n\u5ee3\u64ad\n\u5176\u4ed6\n\u7814\u7a76\u51fa\u7248\n\u7814\u7a76\u51fa\u7248\n\u7814\u7a76\u51fa\u7248\n\u6b77\u5e74\u7814\u7a76\u8a08\u756b\n\u5716\u66f8\n\u75ab\u60c5\u5831\u5c0e\nQ&A\nQ&A\nQ&A\n\u57fa\u790e\u7bc7\n\u9632\u868a\u7bc7\n\u9632\u75ab\u7bc7\n\u5c31\u91ab\u6cbb\u7642\u7bc7\n\u6771\u5357\u4e9e\u5730\u5340\u767b\u9769\u71b1\u75ab\u60c5\u56b4\u5cfb\uff0c\u75be\u7ba1\u7f72\u547c\u7c72\u570b\u4eba\u524d\u5f80\u9ad8\u98a8\u96aa\u5730\u5340\u52d9\u5fc5\u505a\u597d\u9632\u868a\u63aa\u65bd\nFacebook Line Print\nBack\n( alt + \u2190 Back)\n\u4f9d\u64da\u75be\u75c5\u7ba1\u5236\u7f72\u75ab\u60c5\u76e3\u6e2c\u8cc7\u6599\uff0c\u76ee\u524d\u6771\u5357\u4e9e\u6578\u570b\u5982\u65b0\u52a0\u5761\u3001\u99ac\u4f86\u897f\u4e9e\u53ca\u6cf0\u570b\u7b49\u767b\u9769\u71b1\u75ab\u60c5\u983b\u50b3\uff0c\u5176\u4e2d\u65b0\u52a0\u5761\u622a\u81f3\u7b2c6\u9031\u7d2f\u8a08\u901a\u58312,162\u4f8b\u767b\u9769\u71b1\u75c5\u4f8b\uff0c\u70ba\u53bb(102)\u5e74\u540c\u671f\u76841.5\u500d\uff0c\u8fd15\u5e74\u540c\u671f\u5e73\u5747\u76843.7\u500d\uff1b\u99ac\u4f86\u897f\u4e9e\u767b\u9769\u71b1\u75ab\u60c5\uff0c\u6bcf\u9031\u65b0\u589e\u7d042\u5343\u4f8b\u7684\u5e45\u5ea6\u6301\u7e8c\u589e\u52a0\uff0c\u4eca\u5e74\u81f32\u6708\u521d\u5df2\u7d2f\u8a08\u901a\u583111,870\u4f8b\uff0c\u70ba\u53bb\u5e74\u540c\u671f\u76843.8\u500d\u3002\u75be\u7ba1\u7f72\u547c\u7c72\u570b\u4eba\uff0c\u524d\u5f80\u767b\u9769\u71b1\u9ad8\u98a8\u96aa\u5730\u5340\u52d9\u5fc5\u505a\u597d\u9632\u868a\u63aa\u65bd\uff0c\u907f\u514d\u611f\u67d3\u767b\u9769\u71b1\u3002\n\u4eca\u5e74\u622a\u81f32\u670818\u65e5\uff0c\u570b\u5167\u5171\u7d2f\u8a0821\u4f8b\u5883\u5916\u79fb\u5165\u767b\u9769\u71b1\u75c5\u4f8b\uff0c\u611f\u67d3\u4f86\u6e90\u5206\u5225\u70ba\u5370\u5c3c9\u4f8b\u3001\u99ac\u4f86\u897f\u4e9e6\u4f8b\u3001\u83f2\u5f8b\u8cd33\u4f8b\u3001\u65b0\u52a0\u57612\u4f8b\u53ca\u67ec\u57d4\u5be81\u4f8b\u3002\u53bb\u5e74\u540c\u671f\u5247\u670924\u4f8b\uff0c\u4e3b\u8981\u4f86\u81ea\u5370\u5c3c\uff088\u4f8b\uff09\u53ca\u6cf0\u570b\uff086\u4f8b\uff09\u3002\n\u75be\u7ba1\u7f72\u63d0\u9192\uff0c\u570b\u4eba\u524d\u5f80\u767b\u9769\u71b1\u9ad8\u98a8\u96aa\u5730\u5340\u65c5\u904a\u3001\u63a2\u89aa\u53ca\u7d93\u5546\uff0c\u61c9\u78ba\u5be6\u505a\u597d\u500b\u4eba\u9632\u868a\u63aa\u65bd\uff0c\u65bc\u8eab\u9ad4\u88f8\u9732\u8655\u4f7f\u7528\u7d93\u885b\u751f\u798f\u5229\u90e8\u6838\u53ef\u7684\u9632\u868a\u85e5\u5291\uff0c\u4e26\u76e1\u91cf\u7a7f\u8457\u6dfa\u8272\u9577\u8896\u8863\u8932\uff0c\u4ee5\u907f\u514d\u906d\u75c5\u5a92\u868a\u53ee\u54ac\u3002\u65c5\u904a\u671f\u9593\u6216\u56de\u570b\u5f8c\u5982\u51fa\u73fe\u767c\u71d2\u3001\u982d\u75db\u3001\u5641\u5fc3\u3001\u5614\u5410\u3001\u808c\u75db\u3001\u51fa\u75b9\u53ca\u95dc\u7bc0\u75db\u7b49\u75c7\u72c0\uff0c\u61c9\u5118\u901f\u5c31\u91ab\uff0c\u4e26\u544a\u77e5\u91ab\u5e2b\u65c5\u904a\u53f2\uff0c\u4ee5\u5229\u53ca\u65e9\u8a3a\u65b7\u6cbb\u7642\u3002\n\u6709\u95dc\u767b\u9769\u71b1\u6700\u65b0\u75ab\u60c5\u53ca\u5404\u9805\u8cc7\u8a0a\uff0c\u8acb\u53c3\u95b1\u75be\u75c5\u7ba1\u5236\u7f72\u5168\u7403\u8cc7\u8a0a\u7db2(http://www.cdc.gov.tw) \u6216\u64a5\u6253\u570b\u5167\u514d\u4ed8\u8cbb\u9632\u75ab\u5c08\u7dda1922\u6d3d\u8a62\uff0c\u5982\u8a71\u6a5f\u7121\u6cd5\u64a5\u6253\u7c21\u78bc\u96fb\u8a71\u865f\u78bc\uff0c\u8acb\u6539\u64a50800-001922\u9632\u75ab\u5c08\u7dda\u3002\nPublishTime 2014/2/21\n:::\nSitemap\nAbout CDC\nAbout CDC\nPolicies\nNHCC\nActs and Regulations\nPublications\nDiseases & Conditions\nImportant Diseases\nTravelers\u2019 Health\nQuarantine\nTravel Health Notices\nForeigners\u2019 Health\nInfection Control and Biosafety\nVaccine-Preventable Diseases Control\nPrograms & Campaigns\nResearch & Development\nEnd TB Special Project\nPreparedness and Response\nField Epidemiology Training Program\nResearch Reports\nInternship(training) Programs Guidelines\nData & Statistics\nTaiwan National Infectious Disease Statistics System\nStatistics of HIV/AIDS\nDisease Surveillance Express\nInfluenza Express\nNational Notifiable Disease Surveillance Report\nWeekly Report of Enterovirus Infection\nTaiwan Healthcare-associated infection and Antimicrobial resistance Surveillance System\nTaiwan CDC Open Data Portal\nInternational Cooperation\nTaiwan IHR National Focal Point Contact Information\nInternational Cooperation\nInternational Conference\nAPEC Related Events\nForeign Visitors\nRelative Resources\nSchool Visits\nNews\nPress Releases\nEvents\nCurrent Topics\nPrivacy Policy\nSecurity Policy\nGovernment Website Open Information Announcement\nDirector-mail\nCopyright Notice on Health Educational Materials\nTaiwan Centers for Disease Control\nNo.6, Linsen S. Rd., Jhongjheng District, Taipei City 100008, Taiwan (R.O.C.) MAP\nTEL\uff1a886-2-2395-9825\nCopyright \u00a9 2026 Taiwan Centers for Disease Control. All rights reserved.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/2ae7cf86-f9eb-4f45-ad30-313f809fc1c5", "content_hash": "6a288515cdf941ec378175bdbf51f5ec053084ac927978ff63874eae6a183355", "created_at": "2026-03-28T05:11:10.083408892Z"}
{"id": "4911edf3-9590-4ea9-9d1f-1b4068a42adf", "source": "brain", "text": "Roberts JD - Search Results - PubMed\n\nRoberts JD - Search Results - PubMed\nThis site needs JavaScript to work properly. Please enable it to take advantage of the complete set of features!\nClipboard, Search History, and several other advanced features are temporarily unavailable.\nSkip to main page content\nAn official website of the United States government\nHere's how you know\nThe .gov means it\u2019s official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you\u2019re on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard\nPublications\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nSearch Page\nSearch:\nSearch\nAdvanced Create alert Create RSS Clipboard\nUser Guide\nFilters 0\nSort by: Computed author Best match Most recent Publication date First author Journal\nDisplay options\nDisplay options\nFormat Summary Abstract PubMed PMID\nPer page 10 20 50 100 200\nAbstract snippets\nShow\nHide\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nSave citations to file\nSelection: All results on this page All results Selection\nFormat: Summary (text) PubMed PMID Abstract (text) CSV\nCreate file\nCancel\nEmail citations\nEmail address has not been verified. Go to My NCBI account settings to confirm your email and then refresh this page.\nTo:\nSubject:\nBody:\nSelection: All results on this page All results Selection\nFormat: Summary Summary (text) Abstract Abstract (text)\nMeSH and other data\nSend email\nCancel\nSend citations to clipboard\nSelection: All results on this page All results Selection\nSend\nCancel\nAdd to Collections\nSelection: All results on this page All results Selection\nCreate a new collection\nAdd to an existing collection\nName your collection:\nName must be less than 100 characters\nChoose a collection:\nUnable to load your collection due to an error\nPlease try again\nAdd\nCancel\nAdd to My Bibliography\nSelection: All results on this page All results Selection\nMy Bibliography\nUnable to load your delegates due to an error\nPlease try again\nAdd\nCancel\nCreate a file for external citation management software\nSelection: All results on this page All results Selection\nCreate file\nCancel\nYour saved search\nName of saved search:\nSearch terms:\nRoberts JD\nTest search terms\nWould you like email updates of new search results?\nSaved Search Alert Radio Buttons\nYes\nNo\nEmail: (change)\nFrequency: Monthly Weekly Daily\nWhich day? The first Sunday The first Monday The first Tuesday The first Wednesday The first Thursday The first Friday The first Saturday The first day The first weekday\nWhich day? Sunday Monday Tuesday Wednesday Thursday Friday Saturday\nReport format: Summary Summary (text) Abstract Abstract (text) PubMed\nSend at most: 1 item 5 items 10 items 20 items 50 items 100 items 200 items\nSend even when there aren't any new results\nOptional text in email:\nSave\nCancel\nYour RSS Feed\nName of RSS Feed:\nNumber of items displayed: 5 10 15 20 50 100\nCreate RSS\nCancel\nRSS Link\nCopy\nFilters\nMy Custom Filters\nPublication date\n1 year\n5 years\n10 years\nCustom Range\nStart Date\nEnd Date\nClear\nApply\nText availability\nAbstract\nFree full text\nFull text\nArticle attribute\nAssociated data\nArticle type\nBooks and Documents\nClinical Trial\nMeta-Analysis\nRandomized Controlled Trial\nReview\nSystematic Review\nSee all article type filters\nAdditional filters\nAdditional filters\nArticle Language\nEnglish\nSpanish\nSee all article language filters\nSpecies\nHumans\nOther Animals\nSex\nFemale\nMale\nAge\nChild: birth-18 years\nAdult: 19+ years\nAged: 65+ years\nSee all age filters\nOther\nExclude preprints\nMEDLINE\nClear applied filters\nReset filters menu\nSearch Results\nclear all\n667 results\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nClear selection\nPage\nof 14\nSave\nEmail\nSend to\nClipboard\nMy Bibliography\nCollections\nCitation manager\nClear selection\nFilters applied: . Clear all\nResults are displayed in a computed author sort order. The Publication Date timeline is not available.\nSelect search result to email or save\nPage 1\n1\nCite\nMedical marijuana certification for patients with sickle cell disease: a report of a single center experience.\nCurtis SA, Lew D, Spodick J, Hendrickson JE, Minniti CP, Roberts JD. Curtis SA, et al. Among authors: roberts jd. Blood Adv. 2020 Aug 25;4(16):3814-3821. doi: 10.1182/bloodadvances.2020002325. Blood Adv. 2020. PMID: 32790846 Free PMC article.\nCite\nItem in Clipboard\n2\nCite\nComorbidity, Pain, Utilization, and Psychosocial Outcomes in Older versus Younger Sickle Cell Adults: The PiSCES Project.\nMcClish DK, Smith WR, Levenson JL, Aisiku IP, Roberts JD, Roseff SD, Bovbjerg VE. McClish DK, et al. Among authors: roberts jd. Biomed Res Int. 2017;2017:4070547. doi: 10.1155/2017/4070547. Epub 2017 Mar 28. Biomed Res Int. 2017. PMID: 28459058 Free PMC article.\nCite\nItem in Clipboard\n3\nCite\nMarijuana Use in Adults Living with Sickle Cell Disease.\nRoberts JD, Spodick J, Cole J, Bozzo J, Curtis S, Forray A. Roberts JD, et al. Cannabis Cannabinoid Res. 2018 Jul 1;3(1):162-165. doi: 10.1089/can.2018.0001. eCollection 2018. Cannabis Cannabinoid Res. 2018. PMID: 30014039 Free PMC article.\nCite\nItem in Clipboard\n4\nCite\nRed blood cell alloimmunization is associated with lower expression of Fc\u03b3R1 on monocyte subsets in patients with sickle cell disease.\nBalbuena-Merle R, Curtis SA, Devine L, Gibb DR, Karafin MS, Luckey CJ, Tormey CA, Siddon AJ, Roberts JD, Hendrickson JE. Balbuena-Merle R, et al. Among authors: roberts jd. Transfusion. 2019 Oct;59(10):3219-3227. doi: 10.1111/trf.15463. Epub 2019 Jul 29. Transfusion. 2019. PMID: 31355970 Free PMC article.\nCite\nItem in Clipboard\n5\nCite\nUtilization, financial outcomes and stakeholder perspectives of a re-organized adult sickle cell program.\nRousseau R, Weisberg DF, Gorero J, Parwani V, Bozzo J, Kenyon K, Smith C, Cole J, Curtis S, Forray A, Roberts JD. Rousseau R, et al. Among authors: roberts jd. PLoS One. 2020 Jul 24;15(7):e0236360. doi: 10.1371/journal.pone.0236360. eCollection 2020. PLoS One. 2020. PMID: 32706825 Free PMC article.\nCite\nItem in Clipboard\n6\nCite\nBuilding access to care in adult sickle cell disease: defining models of care, essential components, and economic aspects.\nKanter J, Smith WR, Desai PC, Treadwell M, Andemariam B, Little J, Nugent D, Claster S, Manwani DG, Baker J, Strouse JJ, Osunkwo I, Stewart RW, King A, Shook LM, Roberts JD, Lanzkron S. Kanter J, et al. Among authors: roberts jd. Blood Adv. 2020 Aug 25;4(16):3804-3813. doi: 10.1182/bloodadvances.2020001743. Blood Adv. 2020. PMID: 32785684 Free PMC article.\nCite\nItem in Clipboard\n7\nCite\nUrinary cannabinoid mass spectrometry profiles differentiate dronabinol from cannabis use.\nKoch CD, Xu L, Curtis SA, Roberts JD, Bunch DR, El-Khoury JM. Koch CD, et al. Among authors: roberts jd. Clin Chim Acta. 2020 Nov;510:515-521. doi: 10.1016/j.cca.2020.08.014. Epub 2020 Aug 12. Clin Chim Acta. 2020. PMID: 32795544\nCite\nItem in Clipboard\n8\nCite\nDaily Cannabis Users with Sickle Cell Disease Show Fewer Admissions than Others with Similar Pain Complaints.\nCurtis SA, Brandow AM, DeVeaux M, Zeltermam D, Devine L, Roberts JD. Curtis SA, et al. Among authors: roberts jd. Cannabis Cannabinoid Res. 2020 Sep 2;5(3):255-262. doi: 10.1089/can.2019.0036. eCollection 2020. Cannabis Cannabinoid Res. 2020. PMID: 32923662 Free PMC article.\nCite\nItem in Clipboard\n9\nCite\nNon-crisis related pain occurs in adult patients with sickle cell disease despite chronic red blood cell exchange transfusion therapy.\nCurtis SA, Raisa BM, Roberts JD, Hendrickson JE, Starrels J, Lesley D, Michelle D, Daniel Z, Brandow AM. Curtis SA, et al. Among authors: roberts jd. Transfus Apher Sci. 2022 Apr;61(2):103304. doi: 10.1016/j.transci.2021.103304. Epub 2021 Oct 30. Transfus Apher Sci. 2022. PMID: 34782244 Free PMC article.\nCite\nItem in Cli", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/4911edf3-9590-4ea9-9d1f-1b4068a42adf", "content_hash": "ae658b42724b1a882e7e8d0776a07993224c84e2b15d1f0c86d23d0b993e13da", "created_at": "2026-03-28T05:11:09.991488032Z"}
{"id": "ecff56e9-12b0-430e-ae55-c4f16f88c566", "source": "brain", "text": "Purification, characterization and protective effects on UVB-induced photoaging in zebrafish of Pleurotus citrinopileatus polysaccharide PCP-2\n\nPurification, characterization and protective effects on UVB-induced photoaging in zebrafish of Pleurotus citrinopileatus polysaccharide PCP-2\nPurification, characterization and protective effects on UVB-induced photoaging in zebrafish of Pleurotus citrinopileatus polysaccharide PCP-2\nJ Sci Food Agric. 2025 Aug 15;105(10):5246-5257. doi: 10.1002/jsfa.14247. Epub 2025 Mar 28.\nAuthors\nYan-Xia Li 1 , He Ma 1 , Le Shi 1 , Zhong-Fei Zhang 1 , Yu-Meng Wu 1 , Chao Yan 1 2 , Yan Chen 1 2 , Yong-Ming Lu 1 2\nAffiliations\n1 School of Life Sciences, Anhui University, Hefei, People's Republic of China.\n2 Key Laboratory of Ecological Engineering and Biotechnology of Anhui Province and Anhui Key Laboratory of Modern Biomanufacturing, Hefei, People's Republic of China.\nPMID: 40156221\nDOI: 10.1002/jsfa.14247\nAbstract\nBackground: Polysaccharides from Pleurotus citrinopileatus exhibit diverse bioactivities, yet their efficacy against ultraviolet B (UVB)-induced photoaging remains unexplored. This study aimed to purify and characterize a specific PCP and assess its protective effects using a UVB-induced zebrafish model.\nResults: A polysaccharide, designated as PCP-2, was isolated from P. citrinopileatus through hot-water extraction, ultrafiltration and chromatography. PCP-2 is a galactoglucan with a molecular weight of 1.52 \u00d7 106 Da, predominantly composed of 1,4-linked glucopyranosyl and 1,4,6-linked galactopyranosyl residues. In UVB-exposed zebrafish, PCP-2 administration resulted in a significant reduction of reactive oxygen species and malondialdehyde levels, alongside enhanced activities of antioxidant enzymes, including superoxide dismutase, catalase and glutathione peroxidase. Additionally, PCP-2 inhibited apoptosis by upregulating Bcl-2 expression and downregulating caspase-3. It also attenuated cellular senescence, as indicated by decreased \u03b2-galactosidase activity and increased telomerase activity. Moreover, PCP-2 promoted the synthesis of type I and III collagen by suppressing matrix metalloproteinases MMP-1 and MMP-3 and reduced melanin production through the downregulation of tyrosinase expression. Mechanistic studies suggested that these protective effects are mediated via activation of the Nrf2/HO-1 signaling pathway.\nConclusion: PCP-2 from P. citrinopileatus effectively mitigates UVB-induced photoaging, primarily by activating the Nrf2/HO-1 pathway. These findings suggest PCP-2's potential as an anti-photoaging agent in both food and pharmaceutical industries. \u00a9 2025 Society of Chemical Industry.\nKeywords: Pleurotus citrinopileatus polysaccharide; anti\u2010photoaging; zebrafish.\n\u00a9 2025 Society of Chemical Industry.\nMeSH terms\nAnimals\nAntioxidants / chemistry\nAntioxidants / isolation & purification\nAntioxidants / pharmacology\nApoptosis / drug effects\nApoptosis / radiation effects\nCaspase 3 / genetics\nCaspase 3 / metabolism\nCatalase / genetics\nCatalase / metabolism\nGlutathione Peroxidase / genetics\nGlutathione Peroxidase / metabolism\nHumans\nMalondialdehyde / metabolism\nMatrix Metalloproteinase 1 / genetics\nMatrix Metalloproteinase 1 / metabolism\nPleurotus* / chemistry\nPolysaccharides* / administration & dosage\nPolysaccharides* / chemistry\nPolysaccharides* / isolation & purification\nPolysaccharides* / pharmacology\nProtective Agents* / chemistry\nProtective Agents* / isolation & purification\nProtective Agents* / pharmacology\nReactive Oxygen Species / metabolism\nSkin / drug effects\nSkin / metabolism\nSkin / radiation effects\nSkin Aging* / drug effects\nSkin Aging* / radiation effects\nSuperoxide Dismutase / genetics\nSuperoxide Dismutase / metabolism\nUltraviolet Rays / adverse effects\nZebrafish\nSubstances\nPolysaccharides\nReactive Oxygen Species\nProtective Agents\nSuperoxide Dismutase\nMalondialdehyde\nCatalase\nMatrix Metalloproteinase 1\nGlutathione Peroxidase\nAntioxidants\nCaspase 3\nGrants and funding\nThis work was supported by the Key Project of Science and Technology of Anhui Province (2023n06020008) and Educational Commission of Anhui Province of China (KJ2020A0051)\nKey Project of Science and Technology of Anhui Province (2023n06020008) and Educational Commission of Anhui Province of China (KJ2020A0051)", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/ecff56e9-12b0-430e-ae55-c4f16f88c566", "content_hash": "7bbd887fb8342a364d2426b6d2f6a9bb75874bc5c96f3a2350c39ccf2ad391ee", "created_at": "2026-03-28T05:11:09.896219373Z"}
{"id": "cbff5c8e-06b4-4ae4-8efd-039328260e4e", "source": "brain", "text": "Glucose-6-phosphatase catalytic subunit gene family\n\nGlucose-6-phosphatase catalytic subunit gene family\nGlucose-6-phosphatase catalytic subunit gene family\nJ Biol Chem. 2009 Oct 23;284(43):29241-5. doi: 10.1074/jbc.R109.025544. Epub 2009 Aug 20.\nAuthors\nJohn C Hutton 1 , Richard M O'Brien\nAffiliation\n1 Barbara Davis Center for Childhood Diabetes, University of Colorado at Denver, Aurora, Colorado 80045, USA.\nPMID: 19700406\nPMCID: PMC2785553\nDOI: 10.1074/jbc.R109.025544\nAbstract\nGlucose-6-phosphatase catalyzes the hydrolysis of glucose 6-phosphate (G6P) to glucose and inorganic phosphate. It is a multicomponent system located in the endoplasmic reticulum that comprises several integral membrane proteins, namely a catalytic subunit (G6PC) and transporters for G6P, inorganic phosphate, and glucose. The G6PC gene family contains three members, designated G6PC, G6PC2, and G6PC3. The tissue-specific expression patterns of these genes differ, and mutations in all three genes have been linked to distinct diseases in humans. This minireview discusses the disease association and transcriptional regulation of the G6PC genes as well as the biological functions of the encoded proteins.\nPublication types\nResearch Support, N.I.H., Extramural\nResearch Support, Non-U.S. Gov't\nReview\nMeSH terms\nAnimals\nCarbohydrate Metabolism, Inborn Errors / enzymology*\nCarbohydrate Metabolism, Inborn Errors / genetics\nCarrier Proteins / genetics\nCarrier Proteins / metabolism\nCatalytic Domain / genetics\nEndoplasmic Reticulum / enzymology*\nEndoplasmic Reticulum / genetics\nGene Expression Regulation, Enzymologic*\nGlucose-6-Phosphatase / genetics\nGlucose-6-Phosphatase / metabolism*\nHumans\nHydrolysis\nMultigene Family*\nMultiprotein Complexes / genetics\nMultiprotein Complexes / metabolism\nMutation*\nOrgan Specificity\nTranscription, Genetic / genetics\nSubstances\nCarrier Proteins\nMultiprotein Complexes\nGlucose-6-Phosphatase\nGrants and funding\nP30 DK057516/DK/NIDDK NIH HHS/United States\nP60 DK020593/DK/NIDDK NIH HHS/United States\nR01 DK076027/DK/NIDDK NIH HHS/United States\nDK052068/DK/NIDDK NIH HHS/United States\nDK56374/DK/NIDDK NIH HHS/United States\nP30 DK57516/DK/NIDDK NIH HHS/United States\nR56 DK052068/DK/NIDDK NIH HHS/United States\nDK076027/DK/NIDDK NIH HHS/United States\nR01 DK061645/DK/NIDDK NIH HHS/United States\nR01 DK056374/DK/NIDDK NIH HHS/United States\nDK76027/DK/NIDDK NIH HHS/United States\nR01 DK052068/DK/NIDDK NIH HHS/United States\nP60 DK20593/DK/NIDDK NIH HHS/United States\nDK61645/DK/NIDDK NIH HHS/United States", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/cbff5c8e-06b4-4ae4-8efd-039328260e4e", "content_hash": "337ba4f244a86def55ba8f0c1d04af22d2ae9fccc3c8a3ac6309f803f625b2c0", "created_at": "2026-03-28T05:11:09.802015319Z"}
{"id": "0f2a219f-986a-48ca-9247-79ffab746f8e", "source": "brain", "text": "tf.raw_ops.NonMaxSuppressionV2 | TensorFlow v2.16.1\n\ntf.raw_ops.NonMaxSuppressionV2 | TensorFlow v2.16.1\nSkip to main content\nInstall Learn\nIntroduction\nNew to TensorFlow?\nTutorials\nLearn how to use TensorFlow with end-to-end examples\nGuide\nLearn framework concepts and components\nLearn ML\nEducational resources to master your path with TensorFlow\nAPI\nTensorFlow (v2.16.1)\nVersions\u2026\nTensorFlow.js\nTensorFlow Lite\nTFX\nEcosystem\nLIBRARIES\nTensorFlow.js\nDevelop web ML applications in JavaScript\nTensorFlow Lite\nDeploy ML on mobile, microcontrollers and other edge devices\nTFX\nBuild production ML pipelines\nAll libraries\nCreate advanced models and extend TensorFlow\nRESOURCES\nModels & datasets\nPre-trained models and datasets built by Google and the community\nTools\nTools to support and accelerate TensorFlow workflows\nResponsible AI\nResources for every stage of the ML workflow\nRecommendation systems\nBuild recommendation systems with open source tools\nCommunity\nGroups\nUser groups, interest groups and mailing lists\nContribute\nGuide for contributing to code and documentation\nBlog\nStay up to date with all things TensorFlow\nForum\nDiscussion platform for the TensorFlow community\nWhy TensorFlow\nAbout\nCase studies\n/\nEnglish\n\u4e2d\u6587 \u2013 \u7b80\u4f53\nGitHub Sign in\nTensorFlow v2.16.1\nOverview Python C++ Java More\nInstall\nLearn\nMore\nAPI\nMore\nOverview\nPython\nC++\nJava\nMore\nEcosystem\nMore\nCommunity\nMore\nWhy TensorFlow\nMore\nGitHub\nOverview\nAll Symbols\nPython v2.16.1\ntf\nOverview\nAggregationMethod\nCriticalSection\nDeviceSpec\nGradientTape\nGraph\nIndexedSlices\nIndexedSlicesSpec\nModule\nOperation\nOptionalSpec\nRaggedTensor\nRaggedTensorSpec\nRegisterGradient\nSparseTensorSpec\nTensor\nTensorArray\nTensorArraySpec\nTensorShape\nTensorSpec\nTypeSpec\nUnconnectedGradients\nVariable\nVariable.SaveSliceInfo\nVariableAggregation\nVariableSynchronization\napprox_top_k\nargsort\nbatch_to_space\nbitcast\nboolean_mask\nbroadcast_dynamic_shape\nbroadcast_static_shape\nbroadcast_to\ncase\ncast\nclip_by_global_norm\nclip_by_norm\nclip_by_value\nconcat\ncond\nconstant\nconstant_initializer\ncontrol_dependencies\nconv\nconv2d_backprop_filter_v2\nconv2d_backprop_input_v2\nconvert_to_tensor\ncustom_gradient\ndevice\ndynamic_partition\ndynamic_stitch\nedit_distance\neinsum\nensure_shape\nexecuting_eagerly\nexpand_dims\nextract_volume_patches\neye\nfftnd\nfill\nfingerprint\nfoldl\nfoldr\nfunction\ngather\ngather_nd\nget_current_name_scope\nget_logger\nget_static_value\ngrad_pass_through\ngradients\ngroup\nguarantee_const\nhessians\nhistogram_fixed_width\nhistogram_fixed_width_bins\nidentity\nidentity_n\nifftnd\ninit_scope\ninside_function\nirfftnd\nis_symbolic_tensor\nis_tensor\nlinspace\nload_library\nload_op_library\nmake_ndarray\nmake_tensor_proto\nmap_fn\nmeshgrid\nname_scope\nno_gradient\nno_op\nnondifferentiable_batch_function\nnorm\nnumpy_function\none_hot\nones\nones_initializer\nones_like\npad\nparallel_stack\nprint\npy_function\nragged_fill_empty_rows\nragged_fill_empty_rows_grad\nrandom_index_shuffle\nrandom_normal_initializer\nrandom_uniform_initializer\nrange\nrank\nrealdiv\nrecompute_grad\nregister_tensor_conversion_function\nrepeat\nrequired_space_to_batch_paddings\nreshape\nreverse\nreverse_sequence\nrfftnd\nroll\nscan\nscatter_nd\nsearchsorted\nsequence_mask\nshape\nshape_n\nsize\nslice\nsort\nspace_to_batch\nspace_to_batch_nd\nsplit\nsqueeze\nstack\nstop_gradient\nstrided_slice\nswitch_case\ntensor_scatter_nd_add\ntensor_scatter_nd_max\ntensor_scatter_nd_min\ntensor_scatter_nd_sub\ntensor_scatter_nd_update\ntensordot\ntile\ntimestamp\ntranspose\ntruncatediv\ntruncatemod\ntuple\ntype_spec_from_value\nunique\nunique_with_counts\nunravel_index\nunstack\nvariable_creator_scope\nvectorized_map\nwhere\nwhile_loop\nzeros\nzeros_initializer\nzeros_like\ntf.audio\nOverview\ndecode_wav\nencode_wav\ntf.autodiff\nOverview\nForwardAccumulator\ntf.autograph\nOverview\nset_verbosity\nto_code\nto_graph\ntrace\nexperimental\nOverview\nFeature\ndo_not_convert\nset_loop_options\ntf.bitwise\nOverview\nbitwise_and\nbitwise_or\nbitwise_xor\ninvert\nleft_shift\nright_shift\ntf.compat\nOverview\nas_bytes\nas_str\nas_str_any\nas_text\ndimension_at_index\ndimension_value\nforward_compatibility_horizon\nforward_compatible\npath_to_str\nv1\nOverview\nAttrValue\nAttrValue.ListValue\nConditionalAccumulator\nConditionalAccumulatorBase\nConfigProto\nConfigProto.DeviceCountEntry\nConfigProto.Experimental\nDeviceSpec\nDimension\nEvent\nFixedLengthRecordReader\nGPUOptions\nGPUOptions.Experimental\nGPUOptions.Experimental.VirtualDevices\nGraphDef\nGraphKeys\nGraphOptions\nHistogramProto\nIdentityReader\nInteractiveSession\nLMDBReader\nLogMessage\nMetaGraphDef\nMetaGraphDef.CollectionDefEntry\nMetaGraphDef.MetaInfoDef\nMetaGraphDef.MetaInfoDef.FunctionAliasesEntry\nMetaGraphDef.SignatureDefEntry\nNameAttrList\nNameAttrList.AttrEntry\nNodeDef\nNodeDef.AttrEntry\nNodeDef.ExperimentalDebugInfo\nOptimizerOptions\nPrint\nReaderBase\nRunMetadata\nRunMetadata.FunctionGraphs\nRunOptions\nRunOptions.Experimental\nRunOptions.Experimental.RunHandlerPoolOptions\nSession\nSessionLog\nSparseConditionalAccumulator\nSparseTensorValue\nSummary\nSummary.Audio\nSummary.Image\nSummary.Value\nSummaryMetadata\nSummaryMetadata.PluginData\nTFRecordReader\nTensorInfo\nTensorInfo.CompositeTensor\nTensorInfo.CooSparse\nTextLineReader\nVariable\nVariableAggregation\nVariableScope\nWholeFileReader\nadd_check_numerics_ops\nadd_to_collection\nadd_to_collections\nall_variables\narg_max\narg_min\nargmax\nargmin\nassert_equal\nassert_greater\nassert_greater_equal\nassert_integer\nassert_less\nassert_less_equal\nassert_near\nassert_negative\nassert_non_negative\nassert_non_positive\nassert_none_equal\nassert_positive\nassert_rank\nassert_rank_at_least\nassert_rank_in\nassert_scalar\nassert_type\nassert_variables_initialized\nassign\nassign_add\nassign_sub\nbatch_gather\nbatch_scatter_update\nbatch_to_space\nbatch_to_space_nd\nbincount\nboolean_mask\ncase\nclip_by_average_norm\ncolocate_with\ncond\nconfusion_matrix\nconstant\nconstant_initializer\ncontainer\ncontrol_flow_v2_enabled\nconvert_to_tensor\nconvert_to_tensor_or_indexed_slices\nconvert_to_tensor_or_sparse_tensor\ncount_nonzero\ncount_up_to\ncreate_partitioned_variables\ndecode_csv\ndecode_raw\ndelete_session_tensor\ndepth_to_space\ndevice\ndisable_control_flow_v2\ndisable_eager_execution\ndisable_resource_variables\ndisable_tensor_equality\ndisable_v2_behavior\ndisable_v2_tensorshape\ndiv\nenable_control_flow_v2\nenable_eager_execution\nenable_resource_variables\nenable_tensor_equality\nenable_v2_behavior\nenable_v2_tensorshape\nexecuting_eagerly\nexecuting_eagerly_outside_functions\nexpand_dims\nextract_image_patches\nfixed_size_partitioner\nfloor_div\nfoldl\nfoldr\ngather\ngather_nd\nget_collection\nget_collection_ref\nget_default_graph\nget_default_session\nget_local_variable\nget_seed\nget_session_handle\nget_session_tensor\nget_variable\nget_variable_scope\nglobal_variables\nglobal_variables_initializer\nglorot_normal_initializer\nglorot_uniform_initializer\ngradients\nhessians\ninitialize_all_tables\ninitialize_all_variables\ninitialize_local_variables\ninitialize_variables\nis_variable_initialized\nload_file_system_library\nlocal_variables\nlocal_variables_initializer\nmake_template\nmap_fn\nmin_max_variable_partitioner\nmodel_variables\nmoving_average_variables\nmultinomial\nname_scope\nno_regularizer\nnorm\nones_initializer\nones_like\nop_scope\northogonal_initializer\npad\nparse_example\nparse_single_example\nplaceholder\nplaceholder_with_default\npy_func\nquantize_v2\nrandom_normal_initializer\nrandom_poisson\nrandom_uniform_initializer\nreduce_all\nreduce_any\nreduce_join\nreduce_logsumexp\nreduce_max\nreduce_mean\nreduce_min\nreduce_prod\nreduce_sum\nreport_uninitialized_variables\nreset_default_graph\nresource_variables_enabled\nreverse_sequence\nscalar_mul\nscan\nscatter_add\nscatter_div\nscatter_max\nscatter_min\nscatter_mul\nscatter_nd_add\nscatter_nd_sub\nscatter_nd_update\nscatter_sub\nscatter_update\nserialize_many_sparse\nserialize_sparse\nset_random_seed\nsetdiff1d\nshape\nsize\nspace_to_batch\nspace_to_depth\nsparse_add\nsparse_concat\nsparse_matmul\nsparse_merge\nsparse_placeholder\nsparse_reduce_max\nsparse_reduce_max_sparse\nsparse_reduce_sum\nsparse_reduce_sum_sparse\nsparse_segment_mean\nsparse_segment_sqrt_n\nsparse_segment_sum\nsparse_split\nsparse_to_dense\nsqueeze\nstring_split\nstring_to_hash_bucket\nstring_to_number\nsubstr\ntables_initializer\nto_bfloat", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/0f2a219f-986a-48ca-9247-79ffab746f8e", "content_hash": "2ebee97ec0bf3299e627f53bfdba7a7657b5d2ec8b1dc72a45b3f3c1b0f7b2f9", "created_at": "2026-03-28T05:10:46.177099514Z"}
{"id": "0748f42e-e20d-4f9f-b512-00c503ec44ab", "source": "brain", "text": "Linking Soil CO2 Efflux to Individual Trees: Size-Dependent Variation and the Importance of the Birch Effect\n\nLinking Soil CO2 Efflux to Individual Trees: Size-Dependent Variation and the Importance of the Birch Effect\nNext Article in Journal\nAcknowledgment to Reviewers of Soil Systems in 2020\nPrevious Article in Journal\nHave Sustained Acidic Deposition Decreases Led to Increased Calcium Availability in Recovering Watersheds of the Adirondack Region of New York, USA?\nJournals\nActive Journals Find a Journal Journal Proposal Proceedings Series\nTopics\nInformation\nFor Authors For Reviewers For Editors For Librarians For Publishers For Societies For Conference Organizers\nOpen Access Policy Institutional Open Access Program Special Issues Guidelines Editorial Process Research and Publication Ethics Article Processing Charges Awards Testimonials\nAuthor Services\nInitiatives\nSciforum MDPI Books Preprints.org Scilit SciProfiles Encyclopedia JAMS Proceedings Series\nAbout\nOverview Contact Careers News Press Blog\nSign In / Sign Up\nNotice\nYou can make submissions to other journals here.\nclear\nNotice\nYou are accessing a machine-readable page. In order to be human-readable, please install an RSS reader.\nContinue Cancel\nclear\nAll articles published by MDPI are made immediately available worldwide under an open access license. No special permission is required to reuse all or part of the article published by MDPI, including figures and tables. For articles published under an open access Creative Common CC BY license, any part of the article may be reused without permission provided that the original article is clearly cited. For more information, please refer to https://www.mdpi.com/openaccess.\nFeature papers represent the most advanced research with significant potential for high impact in the field. A Feature Paper should be a substantial original Article that involves several techniques or approaches, provides an outlook for future research directions and describes possible research applications.\nFeature papers are submitted upon individual invitation or recommendation by the scientific editors and must receive positive feedback from the reviewers.\nEditor\u2019s Choice articles are based on recommendations by the scientific editors of MDPI journals from around the world. Editors select a small number of articles recently published in the journal that they believe will be particularly interesting to readers, or important in the respective research area. The aim is to provide a snapshot of some of the most exciting work published in the various research areas of the journal.\nOriginal Submission Date Received: .\nYou seem to have javascript disabled. Please note that many of the page functionalities won't work as expected without javascript enabled.\nclear zoom_out_map search menu\nJournals\nActive Journals\nFind a Journal\nJournal Proposal\nProceedings Series\nTopics\nInformation\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nFor Publishers\nFor Societies\nFor Conference Organizers\nOpen Access Policy\nInstitutional Open Access Program\nSpecial Issues Guidelines\nEditorial Process\nResearch and Publication Ethics\nArticle Processing Charges\nAwards\nTestimonials\nAuthor Services\nInitiatives\nSciforum\nMDPI Books\nPreprints.org\nScilit\nSciProfiles\nEncyclopedia\nJAMS\nProceedings Series\nAbout\nOverview\nContact\nCareers\nNews\nPress\nBlog\nSign In / Sign Up Submit\nerror_outline You can access the new MDPI.com website here. Explore and share your feedback with us. close\nSearch for Articles:\nTitle / Keyword\nAuthor / Affiliation / Email\nJournal\nAll Journals Accounting and Auditing Acoustics Acta Microbiologica Hellenica (AMH) Actuators Adhesives Administrative Sciences Adolescents Advances in Respiratory Medicine (ARM) Aerobiology Aerospace Agriculture AgriEngineering Agrochemicals Agronomy AI AI Chemistry AI for Engineering AI in Education AI in Medicine AI Materials AI Sensors Air Algorithms Allergies Alloys Analog Analytica Analytics Anatomia Anesthesia Research Animals Antibiotics Antibodies Antioxidants Applied Biosciences Applied Mechanics Applied Microbiology Applied Nano Applied Sciences Applied System Innovation (ASI) AppliedChem AppliedMath AppliedPhys Aquaculture Journal Architecture Arthropoda Arts Astronautics Astronomy Atmosphere Atoms Audiology Research Automation Axioms Bacteria Batteries Behavioral Sciences Beverages Big Data and Cognitive Computing (BDCC) BioChem Bioengineering Biologics Biology Biology and Life Sciences Forum Biomass Biomechanics BioMed Biomedicines BioMedInformatics Biomimetics Biomolecules Biophysica Bioresources and Bioproducts Biosensors Biosphere BioTech Birds Blockchains Brain Sciences Buildings Businesses C (Journal of Carbon Research) Cancers Cardiogenetics Cardiovascular Medicine Catalysts Cells Ceramics Challenges ChemEngineering Chemistry Chemistry Proceedings Chemosensors Children Chips CivilEng Clean Technologies (Clean Technol.) Climate Clinical and Translational Neuroscience (CTN) Clinical Bioenergetics Clinics and Practice Clocks & Sleep Coasts Coatings Colloids and Interfaces Colorants Commodities Complexities Complications Compounds Computation Computer Sciences & Mathematics Forum Computers Condensed Matter Conservation Construction Materials Corrosion and Materials Degradation (CMD) Cosmetics COVID Craniomaxillofacial Trauma & Reconstruction (CMTR) Crops Cryo Cryptography Crystals Culture Current Issues in Molecular Biology (CIMB) Current Oncology Dairy Data Dentistry Journal Dermato Dermatopathology Designs Diabetology Diagnostics Dietetics Digital Disabilities Diseases Diversity DNA Drones Drugs and Drug Candidates (DDC) Dynamics Earth Ecologies Econometrics Economies Education Sciences Electricity Electrochem Electronic Materials Electronics Emergency Care and Medicine Encyclopedia Endocrines Energies Energy Storage and Applications (ESA) Eng Engineering Proceedings Entropic and Disordered Matter (EDM) Entropy Environmental and Earth Sciences Proceedings Environments Epidemiologia Epigenomes European Burn Journal (EBJ) European Journal of Investigation in Health, Psychology and Education (EJIHPE) Family Sciences Fermentation Fibers FinTech Fire Fishes Fluids Foods Forecasting Forensic Sciences Forests Fossil Studies Foundations Fractal and Fractional (Fractal Fract) Fuels Future Future Internet Future Pharmacology Future Transportation Galaxies Games Gases Gastroenterology Insights Gastrointestinal Disorders Gastronomy Gels Genealogy Genes Geographies GeoHazards Geomatics Geometry Geosciences Geotechnics Geriatrics Germs Glacies Gout, Urate, and Crystal Deposition Disease (GUCDD) Grasses Green Health Hardware Healthcare Hearts Hemato Hematology Reports Heritage Histories Horticulturae Hospitals Humanities Humans Hydrobiology Hydrogen Hydrology Hydropower Hygiene Immuno Industries Infectious Disease Reports Informatics Information Infrastructures Inorganics Insects Instruments Intelligent Infrastructure and Construction International Journal of Cognitive Sciences (IJCS) International Journal of Environmental Medicine (IJEM) International Journal of Environmental Research and Public Health (IJERPH) International Journal of Financial Studies (IJFS) International Journal of Molecular Sciences (IJMS) International Journal of Neonatal Screening (IJNS) International Journal of Orofacial Myology and Myofunctional Therapy (IJOM) International Journal of Plant Biology (IJPB) International Journal of Topology International Journal of Translational Medicine (IJTM) International Journal of Turbomachinery, Propulsion and Power (IJTPP) International Medical Education (IME) Inventions IoT ISPRS International Journal of Geo-Information (IJGI) J Journal of Aesthetic Medicine (J. Aesthetic Med.) Journal of Ageing and Longevity (JAL) Journal of CardioRenal Medicine (JCRM) Journal of Cardiovascular Development and Disease (JCDD) Journal of Clinical & Translational Ophthalmology (JCTO) Journal of Clinical Medicine (JCM) Journal of Composites Science (J. Compos. Sci.) Journal of Cybersecurity and Privacy (JCP) Journal of Dementia and Alzheimer's Disease (JDAD) Journal of De", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/0748f42e-e20d-4f9f-b512-00c503ec44ab", "content_hash": "0fad237312433b0768c9c4a1575f810b46def70acc8d34a51179fda4cc228040", "created_at": "2026-03-28T05:10:46.102033851Z"}
{"id": "48d1c9c2-95ac-4cb7-96c3-8dd7e55b9a19", "source": "brain", "text": "Application of Complex Geophysical Methods for the Detection of Unconsolidated Zones in Flood Dikes\n\nApplication of Complex Geophysical Methods for the Detection of Unconsolidated Zones in Flood Dikes\nNext Article in Journal\nA New Type of Red-Green-Blue Composite and Its Application in Tropical Cyclone Center Positioning\nNext Article in Special Issue\nDisaster Prediction Knowledge Graph Based on Multi-Source Spatio-Temporal Information\nPrevious Article in Journal\nReal-Time Detection of Full-Scale Forest Fire Smoke Based on Deep Convolution Neural Network\nJournals\nActive Journals Find a Journal Journal Proposal Proceedings Series\nTopics\nInformation\nFor Authors For Reviewers For Editors For Librarians For Publishers For Societies For Conference Organizers\nOpen Access Policy Institutional Open Access Program Special Issues Guidelines Editorial Process Research and Publication Ethics Article Processing Charges Awards Testimonials\nAuthor Services\nInitiatives\nSciforum MDPI Books Preprints.org Scilit SciProfiles Encyclopedia JAMS Proceedings Series\nAbout\nOverview Contact Careers News Press Blog\nSign In / Sign Up\nNotice\nYou can make submissions to other journals here.\nclear\nNotice\nYou are accessing a machine-readable page. In order to be human-readable, please install an RSS reader.\nContinue Cancel\nclear\nAll articles published by MDPI are made immediately available worldwide under an open access license. No special permission is required to reuse all or part of the article published by MDPI, including figures and tables. For articles published under an open access Creative Common CC BY license, any part of the article may be reused without permission provided that the original article is clearly cited. For more information, please refer to https://www.mdpi.com/openaccess.\nFeature papers represent the most advanced research with significant potential for high impact in the field. A Feature Paper should be a substantial original Article that involves several techniques or approaches, provides an outlook for future research directions and describes possible research applications.\nFeature papers are submitted upon individual invitation or recommendation by the scientific editors and must receive positive feedback from the reviewers.\nEditor\u2019s Choice articles are based on recommendations by the scientific editors of MDPI journals from around the world. Editors select a small number of articles recently published in the journal that they believe will be particularly interesting to readers, or important in the respective research area. The aim is to provide a snapshot of some of the most exciting work published in the various research areas of the journal.\nOriginal Submission Date Received: .\nYou seem to have javascript disabled. Please note that many of the page functionalities won't work as expected without javascript enabled.\nclear zoom_out_map search menu\nJournals\nActive Journals\nFind a Journal\nJournal Proposal\nProceedings Series\nTopics\nInformation\nFor Authors\nFor Reviewers\nFor Editors\nFor Librarians\nFor Publishers\nFor Societies\nFor Conference Organizers\nOpen Access Policy\nInstitutional Open Access Program\nSpecial Issues Guidelines\nEditorial Process\nResearch and Publication Ethics\nArticle Processing Charges\nAwards\nTestimonials\nAuthor Services\nInitiatives\nSciforum\nMDPI Books\nPreprints.org\nScilit\nSciProfiles\nEncyclopedia\nJAMS\nProceedings Series\nAbout\nOverview\nContact\nCareers\nNews\nPress\nBlog\nSign In / Sign Up Submit\nerror_outline You can access the new MDPI.com website here. Explore and share your feedback with us. close\nSearch for Articles:\nTitle / Keyword\nAuthor / Affiliation / Email\nJournal\nAll Journals Accounting and Auditing Acoustics Acta Microbiologica Hellenica (AMH) Actuators Adhesives Administrative Sciences Adolescents Advances in Respiratory Medicine (ARM) Aerobiology Aerospace Agriculture AgriEngineering Agrochemicals Agronomy AI AI Chemistry AI for Engineering AI in Education AI in Medicine AI Materials AI Sensors Air Algorithms Allergies Alloys Analog Analytica Analytics Anatomia Anesthesia Research Animals Antibiotics Antibodies Antioxidants Applied Biosciences Applied Mechanics Applied Microbiology Applied Nano Applied Sciences Applied System Innovation (ASI) AppliedChem AppliedMath AppliedPhys Aquaculture Journal Architecture Arthropoda Arts Astronautics Astronomy Atmosphere Atoms Audiology Research Automation Axioms Bacteria Batteries Behavioral Sciences Beverages Big Data and Cognitive Computing (BDCC) BioChem Bioengineering Biologics Biology Biology and Life Sciences Forum Biomass Biomechanics BioMed Biomedicines BioMedInformatics Biomimetics Biomolecules Biophysica Bioresources and Bioproducts Biosensors Biosphere BioTech Birds Blockchains Brain Sciences Buildings Businesses C (Journal of Carbon Research) Cancers Cardiogenetics Cardiovascular Medicine Catalysts Cells Ceramics Challenges ChemEngineering Chemistry Chemistry Proceedings Chemosensors Children Chips CivilEng Clean Technologies (Clean Technol.) Climate Clinical and Translational Neuroscience (CTN) Clinical Bioenergetics Clinics and Practice Clocks & Sleep Coasts Coatings Colloids and Interfaces Colorants Commodities Complexities Complications Compounds Computation Computer Sciences & Mathematics Forum Computers Condensed Matter Conservation Construction Materials Corrosion and Materials Degradation (CMD) Cosmetics COVID Craniomaxillofacial Trauma & Reconstruction (CMTR) Crops Cryo Cryptography Crystals Culture Current Issues in Molecular Biology (CIMB) Current Oncology Dairy Data Dentistry Journal Dermato Dermatopathology Designs Diabetology Diagnostics Dietetics Digital Disabilities Diseases Diversity DNA Drones Drugs and Drug Candidates (DDC) Dynamics Earth Ecologies Econometrics Economies Education Sciences Electricity Electrochem Electronic Materials Electronics Emergency Care and Medicine Encyclopedia Endocrines Energies Energy Storage and Applications (ESA) Eng Engineering Proceedings Entropic and Disordered Matter (EDM) Entropy Environmental and Earth Sciences Proceedings Environments Epidemiologia Epigenomes European Burn Journal (EBJ) European Journal of Investigation in Health, Psychology and Education (EJIHPE) Family Sciences Fermentation Fibers FinTech Fire Fishes Fluids Foods Forecasting Forensic Sciences Forests Fossil Studies Foundations Fractal and Fractional (Fractal Fract) Fuels Future Future Internet Future Pharmacology Future Transportation Galaxies Games Gases Gastroenterology Insights Gastrointestinal Disorders Gastronomy Gels Genealogy Genes Geographies GeoHazards Geomatics Geometry Geosciences Geotechnics Geriatrics Germs Glacies Gout, Urate, and Crystal Deposition Disease (GUCDD) Grasses Green Health Hardware Healthcare Hearts Hemato Hematology Reports Heritage Histories Horticulturae Hospitals Humanities Humans Hydrobiology Hydrogen Hydrology Hydropower Hygiene Immuno Industries Infectious Disease Reports Informatics Information Infrastructures Inorganics Insects Instruments Intelligent Infrastructure and Construction International Journal of Cognitive Sciences (IJCS) International Journal of Environmental Medicine (IJEM) International Journal of Environmental Research and Public Health (IJERPH) International Journal of Financial Studies (IJFS) International Journal of Molecular Sciences (IJMS) International Journal of Neonatal Screening (IJNS) International Journal of Orofacial Myology and Myofunctional Therapy (IJOM) International Journal of Plant Biology (IJPB) International Journal of Topology International Journal of Translational Medicine (IJTM) International Journal of Turbomachinery, Propulsion and Power (IJTPP) International Medical Education (IME) Inventions IoT ISPRS International Journal of Geo-Information (IJGI) J Journal of Aesthetic Medicine (J. Aesthetic Med.) Journal of Ageing and Longevity (JAL) Journal of CardioRenal Medicine (JCRM) Journal of Cardiovascular Development and Disease (JCDD) Journal of Clinical & Translational Ophthalmology (JCTO) Journal of Clinical Medicine (JCM) Journal of Composites Science (J. Compos. Sci.) Journal of", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/48d1c9c2-95ac-4cb7-96c3-8dd7e55b9a19", "content_hash": "e51255d66b894ceb966fac649646b77f9576b7f615b3bd94e80c9aaa8b338ddd", "created_at": "2026-03-28T05:10:46.024649674Z"}
{"id": "0d89fd30-ab59-46a5-886b-89c039d05874", "source": "brain", "text": "F\u00eate de l'\u00e9cotourisme - Safari Nature - Jugon-les-lacs\n\nF\u00eate de l'\u00e9cotourisme - Safari Nature - Jugon-les-lacs\nNous contacter\nPlan d\u2019acc\u00e8s et horaires\nAccueil\nL\u2019association\nAgenda des sorties\nAnimations groupes\nGroupes scolaires\nGroupes de loisirs\nP\u00eacher \u00e0 Jugon-Les-Lacs\nFacebook\nS\u00e9lectionner une page\n\u00ab Tous les \u00c9v\u00e8nements\nCet \u00e9v\u00e8nement est pass\u00e9.\nF\u00eate de l\u2019\u00e9cotourisme \u2013 Safari Nature\n18 juin 2023 - 15 h 00 - 17 h 00\nGratuit\n\u00ab Leurre Junior 22 \u2013 Canal de Nantes \u00e0 Brest \u00e0 Bon Repos\nLes enfants parrainent la nature \u00bb\nDans le cadre de la F\u00eate de l\u2019\u00e9cotourisme avec les labels Station Verte et Station P\u00eache, la commune de Jugon-les-lacs Commune Nouvelle propose des animations en mai et juin.\nLe dimanche 18 juin, une sortie \u00ab Safari nature \u00bb est anim\u00e9e par la Maison P\u00eache et Nature : balade de d\u00e9couverte des plantes sauvages comestibles dans le village de Jugon. Vous ne verrez plus les \u00ab mauvaises herbes \u00bb de la m\u00eame mani\u00e8re ! Initiation \u00e0 la reconnaissance des plantes et \u00e0 leurs usages. Sortie familiale, d\u00e9conseill\u00e9e pour les enfants de moins de 7 ans qui n\u2019y trouveraient pas leur int\u00e9r\u00eat.\nGratuit mais r\u00e9servation obligatoire en cliquant sur le bouton suivant (nombre de places limit\u00e9 ; si vous obtenez une page indiquant \u00ab l\u2019\u00e9tablissement n\u2019est pas disponible\u2026 \u00bb c\u2019est que la sortie est compl\u00e8te :\nChargement en cours\u2026\nAjouter au calendrier\nGoogle Agenda\niCalendar\nOutlook 365\nOutlook Live\nD\u00e9tails\nDate : 18 juin 2023\nHeure :\n15 h 00 - 17 h 00\nPrix : Gratuit\nCat\u00e9gorie d\u2019\u00c9v\u00e8nement: Sortie nature\nSite : https://jugonleslacs-communenouvelle.fr/fr/ev/1335479/941852/fete-de-lecotourisme-1\nOrganisateur\nMaison P\u00eache et Nature\nT\u00e9l\u00e9phone <IP_1>.04\nLieu\nMaison P\u00eache et Nature des C\u00f4tes d\u2019Armor\n2 Rue des Grands Moulins\nJugon-les-Lacs, 22270 France + Google Map\n\u00ab Leurre Junior 22 \u2013 Canal de Nantes \u00e0 Brest \u00e0 Bon Repos\nLes enfants parrainent la nature \u00bb\nMaison P\u00eache et Nature\ndes C\u00f4tes d'Armor\n2 Rue des Grands Moulins,\n22270 Jugon-les-Lacs\nT\u00e9l. : 02 96 50 60 04\nNos partenaires\nShare This\nPartager sur Facebook\nPartager sur Twitter", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/0d89fd30-ab59-46a5-886b-89c039d05874", "content_hash": "9a55b9d647ab906ea5dce3619868dc2044ed45321af0d9ca5728c85bc62345a1", "created_at": "2026-03-28T05:10:45.920183509Z"}
{"id": "2baa80b0-404d-40ee-ad57-0bbdb2e2e73e", "source": "brain", "text": "Comprar Cigue\u00f1as al amanecer en nuestra Tienda Online\n\nComprar Cigue\u00f1as al amanecer en nuestra Tienda Online\n<EMAIL_14> 650 977 988\nCarrito Mi cuenta\nInicio\nFotograf\u00edas de Naturaleza\nTienda Online\nTalleres y cursos Fotogr\u00e1ficos\nBIO\nBlog\nCigue\u00f1as al amanecer\nHome\nFotograf\u00edas de Naturaleza\nAves\nCigue\u00f1as al amanecer\nCigue\u00f1as al amanecer\nRef. 387\nAcabados:\nFotograf\u00eda impresa en lienzo con bastidor (40x30)\nFotograf\u00eda impresa en lienzo con bastidor (60x40)\nFotograf\u00eda impresa en lienzo con bastidor(90x60)\n60,00 \u20ac\nA\u00f1adir a Cesta\nRec\u00edbelo en un plazo aproximado de 7-10 d\u00edas\nEn Stock\nEstas fotograf\u00edas est\u00e1n realizadas en unos de los espacios Naturales m\u00e1s importantes de Europa como es el Parque Nacional de Do\u00f1ana y su comarca\nCon mis fotograf\u00edas os quiero trasmitir la gran belleza y magia que nos ofrece la naturaleza.\nFotograf\u00eda impresa en Lienzo\n40x30 60\u20ac\n60x 40 90\u20ac\n90x60 110\u20ac\nFotograf\u00eda impresa en madera\n40x30 70\u20ac\n60x40 99\u20ac\n80x60 120\u20ac\nLa entrega de las fotograf\u00edas ser\u00e1 en un plazo de 7 a 10 d\u00edas\nUna vez se realice el pago, haremos el encargo al laboratorio\nEl envio de la fotograf\u00eda impresa te la haremos a tu domicilio por agencia de transporte\nSi quieres solicitar esta fotograf\u00eda sin montar en madera o lienzo\nEnv\u00eda un correo a <EMAIL_15>\nIndica\nTama\u00f1o que quieres\nReferencia de la fotograf\u00eda\nNombre y apellidos\nTel\u00e9fono\nTe responderemos lo antes posible\nPREGUNTAS sobre\nHACER UNA PREGUNTA\nFotograf\u00edas Relacionadas con Cigue\u00f1as al amanecer\nAves en la laguna\nDueto\nAbejarucos con disputas\nEl ocaso en la marisma\nAmanece en la dehesa de do\u00f1ana\nVuelo al atardecer\nFlamencos bajo la niebla\nCisternas de la bas\u00edlica estambul\nAmanece en la marisma de do\u00f1ana 4\nEl dorado\nJugando con el barrido\nVolando por la marisma de do\u00f1ana\nVER M\u00c1S RELACIONADOS\n60\u20ac\nIVA INC.\nMi\u00e9rcoles, 11 Febrero\nComprar\nCARLOS ROMERO\n<EMAIL_14>\n650 977 988\nCAT\u00c1LOGO\nFotograf\u00edas de Naturaleza\nTienda Online\nTalleres y cursos Fotogr\u00e1ficos\nLEGAL\nSobre Carlos Romero\nCondiciones de compra\nPrivacidad y Cookies\nAvisos legales\nTarifas de envio\nDevoluciones\nCarlos Photo Nature \u00a9 2026. All Rights Reserved.\nTu privacidad es importante para nosotros\nUtilizamos cookies propias y de terceros para mejorar nuestros servicios con fines anal\u00edticos, para la prestaci\u00f3n de otros servicios relacionados con la actividad del sitio web y otros servicios de Internet. Para aceptar su uso, deber\u00e1 pulsar en ACEPTO. As\u00ed mismo, puede configurar o rechazar el uso de cookies pulsando en CONFIGURACI\u00d3N. Para obtener m\u00e1s informaci\u00f3n sobre el uso de las cookies y sus derechos, acceda a nuestra Pol\u00edtica de Cookies.\nConfiguraci\u00f3n Rechazar Aceptar\nGestione su Consentimiento\nT\u00e9cnicas y Funcionales:\nACTIVAS\nAnal\u00edticas:\nT\u00e9cnicas y Funcionales:\nEstr\u00edctamente necesarias para el uso del sitio web y para la prestaci\u00f3n del servicio contratado.\nAnal\u00edticas:\nRecogen informaci\u00f3n del uso que se realiza en la p\u00e1gina web.\nGuardar\nVista Previa del Video\n\u00d7\nYour browser does not support the video tag.\n\u00d7\n* Email\n* PreguntaRespuesta\nEnviar", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/2baa80b0-404d-40ee-ad57-0bbdb2e2e73e", "content_hash": "e3d885981c6d0a8058fd3eebd0f843002ad52bc03ba5e766ee7c7e93d15663d7", "created_at": "2026-03-28T05:10:45.841355114Z"}
{"id": "443b8242-ac8d-4938-90ec-67f8f4a2a778", "source": "brain", "text": "Radiograf\u00eda de la pelvis: MedlinePlus enciclopedia m\u00e9dica\n\nRadiograf\u00eda de la pelvis: MedlinePlus enciclopedia m\u00e9dica\nOmita y vaya al Contenido\nUn sitio oficial del Gobierno de Estados Unidos\nAs\u00ed es como usted puede verificarlo\nAs\u00ed es como usted puede verificarlo\nLos sitios web oficiales usan .gov\nUn sitio web .gov pertenece a una organizaci\u00f3n oficial del Gobierno de Estados Unidos.\nLos sitios web seguros .gov usan HTTPS\nUn candado ( Lock\nLocked padlock icon ) o https:// significa que usted se conect\u00f3 de forma segura a un sitio web .gov. Comparta informaci\u00f3n sensible s\u00f3lo en sitios web oficiales y seguros.\nBiblioteca Nacional de Medicina\nMen\u00fa\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nAcerca de MedlinePlus\nB\u00fasqueda\nBusque en MedlinePlus\nBUSCAR\nAcerca de MedlinePlus\nQu\u00e9 hay de nuevo\n\u00cdndice\nCont\u00e1ctenos\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nEnglish\nUsted est\u00e1 aqu\u00ed:\nP\u00e1gina Principal \u2192\nEnciclopedia m\u00e9dica \u2192\nRadiograf\u00eda de la pelvis\nDirecci\u00f3n de esta p\u00e1gina: //medlineplus.gov/spanish/ency/article/003809.htm\nRadiograf\u00eda de la pelvis\nPara usar las funciones de compartir de esta p\u00e1ginas, por favor, habilite JavaScript.\nUna radiograf\u00eda de la pelvis es una imagen de los huesos de ambas caderas y alrededor de ellas. La pelvis conecta las piernas al cuerpo.\nForma en que se realiza el examen\nEl examen lo realiza un t\u00e9cnico en rayos X en una sala de radiolog\u00eda o en el consultorio del proveedor de atenci\u00f3n m\u00e9dica.\nUsted se acostar\u00e1 sobre la mesa. Luego se toman las radiograf\u00edas. Es posible que tenga que mover su cuerpo a otras posiciones para proporcionar diferentes planos.\nPreparaci\u00f3n para el examen\nInf\u00f3rmele al proveedor si est\u00e1 embarazada. Qu\u00edtese todas las joyas, especialmente alrededor del abdomen y las piernas. Usted usar\u00e1 una bata de hospital.\nLo que se siente durante el examen\nLas radiograf\u00edas son indoloras. Cambiar de posici\u00f3n puede causar molestias.\nRazones por las que se realiza el examen\nLa radiograf\u00eda se utiliza para detectar:\nFracturas\nTumores\nAfecciones degenerativas de los huesos en la cadera, la pelvis y la parte superior de las piernas\nForma anormal de los huesos o articulaciones\nSignificado de los resultados anormales\nLos resultados anormales pueden sugerir:\nFracturas p\u00e9lvicas\nArtritis de la articulaci\u00f3n de la cadera\nTumores de los huesos de la pelvis\nSacroilitis (inflamaci\u00f3n de la zona donde el sacro se une con el hueso ilion)\nEspondilitis anquilosante (rigidez anormal de la columna y la articulaci\u00f3n)\nArtritis en la columna baja\nAnormalidad en la forma de la pelvis o la articulaci\u00f3n de la cadera\nRiesgos\nLos ni\u00f1os y los fetos de mujeres embarazadas son m\u00e1s sensibles a la radiaci\u00f3n de las radiograf\u00edas. Se puede utilizar un escudo protector sobre las zonas que no se est\u00e1n examinando o se pueden utilizar otras modalidades de diagn\u00f3stico por imagen.\nNombres alternativos\nRadiograf\u00eda - pelvis\nIm\u00e1genes\nSacro\nAnatom\u00eda esquel\u00e9tica anterior\nReferencias\nBeebe MJ. Fractures of the acetabulum and pelvis. In: Azar FM, Beaty JH, eds. Campbell's Operative Orthopaedics. 14th ed. Philadelphia, PA: Elsevier; 2021:chap 56.\nKapoor G, Toms AP. Current status of imaging of the musculoskeletal system. In: Adam A, Dixon AK, Gillard JH, Schaefer-Prokop CM, eds. Grainger & Allison's Diagnostic Radiology: A Textbook of Medical Imaging. 7th ed. Philadelphia, PA: Elsevier; 2021:chap 38.\nWilliams KD. Spondylolisthesis. In: Azar FM, Beaty JH, eds. Campbell's Operative Orthopaedics. 14th ed. Philadelphia, PA: Elsevier; 2021:chap 40.\nUltima revisi\u00f3n 4/1/2025\nVersi\u00f3n en ingl\u00e9s revisada por: Jason Levy, MD, FSIR, Northside Radiology Associates, Atlanta, GA. Also reviewed by David C. Dugdale, MD, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A.M. Editorial team.\nTraducci\u00f3n y localizaci\u00f3n realizada por: DrTango, Inc.\nConozca c\u00f3mo citar esta p\u00e1gina\nTemas de salud relacionados\nChequeo m\u00e9dico de la mujer\nDolor p\u00e9lvico\nEspondilitis anquilosante\nLesiones y enfermedades de la cadera\nLesiones y enfermedades de la pierna\nRayos X\nHealth Content Provider\n06/01/2028\nA.D.A.M., Inc. est\u00e1 acreditada por la URAC, tambi\u00e9n conocido como American Accreditation HealthCare Commission (www.urac.org). La acreditaci\u00f3n de la URAC es un comit\u00e9 auditor independiente para verificar que A.D.A.M. cumple los rigurosos est\u00e1ndares de calidad e integridad. A.D.A.M. es una de las primeras empresas en alcanzar esta tan importante distinci\u00f3n en servicios de salud en la red. Conozca m\u00e1s sobre la politica editorial, el proceso editorial, y la poliza de privacidad de A.D.A.M.\nLa informaci\u00f3n aqu\u00ed proporcionada no debe utilizarse durante ninguna emergencia m\u00e9dica ni para el diagn\u00f3stico o tratamiento de ninguna afecci\u00f3n m\u00e9dica. Se debe consultar a un profesional m\u00e9dico autorizado para el diagn\u00f3stico y tratamiento de cualquiera y todas las afecciones m\u00e9dicas. Los enlaces a otros sitios se proporcionan \u00fanicamente con fines informativos; no constituyen una recomendaci\u00f3n de dichos sitios. No se ofrece garant\u00eda alguna, expresa ni impl\u00edcita, en cuanto a la precisi\u00f3n, fiabilidad, puntualidad o exactitud de las traducciones realizadas por un servicio externo de la informaci\u00f3n aqu\u00ed proporcionada a cualquier otro idioma.\n\u00a9 1997- 2026 A.D.A.M., una unidad de negocio de Ebix, Inc. Queda estrictamente prohibida la duplicaci\u00f3n o distribuci\u00f3n de la informaci\u00f3n aqu\u00ed contenida.\nTodo el contenido de este sitio, incluyendo texto, im\u00e1genes, gr\u00e1ficos, audio, video, datos, metadatos y compilaciones, est\u00e1 protegido por derechos de autor y otras leyes de propiedad intelectual. Usted puede ver el contenido para uso personal y no comercial. Cualquier otro uso requiere el consentimiento previo por escrito de Ebix. Usted no puede copiar, reproducir, distribuir, transmitir, mostrar, publicar, realizar ingenier\u00eda inversa, adaptar, modificar, almacenar m\u00e1s all\u00e1 del almacenamiento en cach\u00e9 habitual del navegador, indexar, hacer miner\u00eda de datos, extraer o crear obras derivadas de este contenido. Usted no puede utilizar herramientas automatizadas para acceder o extraer contenido, incluyendo la creaci\u00f3n de incrustaciones, vectores, conjuntos de datos o \u00edndices para sistemas de recuperaci\u00f3n. Se proh\u00edbe el uso de cualquier contenido para entrenar, ajustar, calibrar, probar, evaluar o mejorar sistemas de inteligencia artificial (IA) de cualquier tipo sin el consentimiento expreso por escrito. Esto incluye modelos de lenguaje grandes, modelos de aprendizaje autom\u00e1tico, redes neuronales, sistemas generativos, sistemas de recuperaci\u00f3n aumentada y cualquier software que ingiera contenido para producir resultados. Cualquier uso no autorizado del contenido, incluyendo el uso relacionado con la IA, constituye una violaci\u00f3n de nuestros derechos y puede dar lugar a acciones legales, da\u00f1os y sanciones legales en la medida en que lo permita la ley. Ebix se reserva el derecho de hacer valer sus derechos mediante medidas legales, tecnol\u00f3gicas y contractuales.\nAcerca de MedlinePlus\nQu\u00e9 hay de nuevo\n\u00cdndice\nCont\u00e1ctenos\nRSS\nExenciones\nDerechos de autor\nPol\u00edtica de privacidad\nAccesibilidad\nPautas para enlaces\nVisores y reproductores\nHHS Divulgaci\u00f3n de Vulnerabilidad\nNational Library of Medicine 8600 Rockville Pike, Bethesda, MD 20894 U.S. Department of Health and Human Services National Institutes of Health", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/443b8242-ac8d-4938-90ec-67f8f4a2a778", "content_hash": "8b12ccb64720aaceefc6844d5b7970634c8723c84c166df8f4b37325876f32fe", "created_at": "2026-03-28T05:10:43.951628961Z"}
{"id": "8459be5b-002e-44e4-87e8-1ff515046081", "source": "brain", "text": "Snacks and sweetened drinks - children: MedlinePlus Medical Encyclopedia\n\nSnacks and sweetened drinks - children: MedlinePlus Medical Encyclopedia\nSkip navigation\nAn official website of the United States government\nHere\u2019s how you know\nHere\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nNational Library of Medicine\nThe navigation menu has been collapsed.\nMenu\nHealth Topics\nDrugs & Supplements\nGenetics\nMedical Tests\nMedical Encyclopedia\nAbout MedlinePlus\nShow Search\nSearch MedlinePlus\nGO\nAbout MedlinePlus\nWhat's New\nSite Map\nCustomer Support\nHealth Topics\nDrugs & Supplements\nGenetics\nMedical Tests\nMedical Encyclopedia\nEspa\u00f1ol\nYou Are Here:\nHome \u2192\nMedical Encyclopedia \u2192\nSnacks and sweetened drinks - children\nURL of this page: //medlineplus.gov/ency/patientinstructions/000351.htm\nSnacks and sweetened drinks - children\nTo use the sharing features on this page, please enable JavaScript.\nChoosing healthy snacks and drinks for your children can be hard. There are many options. What is healthy for your child may depend on specific health conditions they have.\nSnacks\nFruits and vegetables are good choices for healthy snacks. They are full of vitamins and do not have added sugar or sodium. Some types of crackers and cheeses also make good snacks. Other healthy snack choices include:\nApples (fresh and cut into wedges or dried without added sugars)\nBananas\nTrail mix with raisins and unsalted nuts\nChopped fruit dipped in yogurt\nRaw vegetables with hummus\nCarrots (regular carrots cut into strips so they are easy to chew, or baby carrots)\nSnap peas (the pods are edible)\nNuts (if your child is not allergic)\nDry cereal (if sugar is not listed as one of the first 2 ingredients)\nPretzels\nString cheese\nPut snacks in small containers so they are easy to carry in a pocket or backpack. Use small containers to help avoid overly large portions.\nAvoid having \"junk food\" snacks like chips, candy, cake, cookies, and ice cream every day. It is easier to keep kids away from these foods if you do not have them in your house and they are a special treat instead of an everyday item.\nIt is OK to let your child have an unhealthy snack once in a while. Children may try to sneak unhealthy food if they are never allowed to have these foods. The key is balance.\nOther things you can do include:\nReplace your candy dish with a fruit bowl.\nIf you have foods like cookies, chips, or ice cream in your house, store them where they are hard to see or reach. Move healthier foods to the front of the pantry and refrigerator, at eye level.\nIf your family snacks while watching TV, put a portion of the food in a bowl or on a plate for each person. It is easy to overeat straight from the package.\nIf you are not sure if a snack is healthy, read the Nutrition Facts label.\nLook closely at the portion size on the label. It is easy to eat more than this amount.\nAvoid snacks that list sugar as one of the first ingredients.\nTry to choose snacks without added sugar or added sodium.\nBeverages\nEncourage children to drink a lot of water.\nAvoid sodas, sport drinks, and flavored waters.\nLimit drinks with added sugar. These may be high in calories and can contribute to undesired weight gain.\nPrepare fruit infused water by steeping strawberries or orange slices in a pitcher for a few hours. You will get a flavored drink with virtually no sugar.\nIf needed, choose beverages with artificial (man-made) sweeteners.\nEven 100% juices can lead to undesired weight gain. A child drinking a 12-ounce (360 milliliters) orange juice every day, in addition to other foods, can gain up to 15 excess pounds (7 kilograms) per year in addition to weight gain from normal growth patterns. Try diluting juices and flavored drinks with water. Start by adding only a little water. Then slowly increase the amount.\nChildren ages 1 to 6 should drink no more than 4 to 6 ounces (120 to 180 milliliters) of 100% fruit juice a day.\nChildren ages 7 to 18 should drink no more than 8 to 12 ounces (240 to 360 milliliters) of 100% fruit juice a day.\nChildren, ages 2 to 8, should drink about 2 cups (480 milliliters) of milk a day. Children older than 8 should have about 3 cups (720 milliliters) a day. It may be helpful to serve milk with meals and water between meals and with snacks.\nOther Tips to Keep in Mind\nThe size of a snack should be the right size for your child. For example, give one half a banana to a 2-year-old and a whole banana to a 10-year-old.\nPick foods that are high in fiber and low in added salt and sugar.\nOffer children fruits, vegetables, and whole-grain snacks instead of sweets.\nFoods that are naturally sweet (such as apple slices, bananas, bell peppers, or baby carrots) are better than foods and drinks that contain added sugar.\nLimit fried foods like French fries, onion rings, and other fried snacks.\nTalk to a nutritionist or your family's health care provider if you need ideas for healthy foods for your family.\nImages\nFruits and vegetables\nReferences\nBarrett KJ, Gilley SP, Haemer MA, Krebs NF, Johnson SL. Feeding healthy infants, children, and adolescents. In: Kliegman RM, St. Geme JW, Blum NJ, et al, eds. Nelson Textbook of Pediatrics. 22nd ed. Philadelphia, PA: Elsevier; 2025:chap 61.\nGahagan S. Overweight and obesity. In: Kliegman RM, St. Geme JW, Blum NJ, et al, eds. Nelson Textbook of Pediatrics. 22nd ed. Philadelphia, PA: Elsevier; 2025:chap 65.\nReview Date 4/1/2025\nUpdated by: Stefania Manetti, RDN, CDCES, RYT200, My Vita Sana LLC - Nourish and heal through food, San Jose, CA. Review provided by VeriMed Healthcare Network. Also reviewed by David C. Dugdale, MD, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A.M. Editorial team.\nLearn how to cite this page\nBrowse the Encyclopedia\nHealth Content Provider\n06/01/2028\nA.D.A.M., Inc. is accredited by URAC, for Health Content Provider (www.urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows rigorous standards of quality and accountability. A.D.A.M. is among the first to achieve this important distinction for online health information and services. Learn more about A.D.A.M.'s editorial policy, editorial process, and privacy policy.\nThe information provided herein should not be used during any medical emergency or for the diagnosis or treatment of any medical condition. A licensed medical professional should be consulted for diagnosis and treatment of any and all medical conditions. Links to other sites are provided for information only -- they do not constitute endorsements of those other sites. No warranty of any kind, either expressed or implied, is made as to the accuracy, reliability, timeliness, or correctness of any translations made by a third-party service of the information provided herein into any other language.\n\u00a9 1997- 2026 A.D.A.M., a business unit of Ebix, Inc. Any duplication or distribution of the information contained herein is strictly prohibited.\nAll content on this site including text, images, graphics, audio, video, data, metadata, and compilations is protected by copyright and other intellectual property laws. You may view the content for personal, noncommercial use. Any other use requires prior written consent from Ebix. You may not copy, reproduce, distribute, transmit, display, publish, reverse-engineer, adapt, modify, store beyond ordinary browser caching, index, mine, scrape, or create derivative works from this content. You may not use automated tools to access or extract content, including to create embeddings, vectors, datasets, or indexes for retrieval systems. Use of any content for training, fine-tuning, calibrating, testing, evaluating, or improving AI systems of any kind is prohibited without express written consent. This includes large language models, machine learning models, neural networks, gen", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/8459be5b-002e-44e4-87e8-1ff515046081", "content_hash": "77634a76d0ef452a18d2a03d977b4abdc0cbeae46d520b0f6d66d8d2f1870a1a", "created_at": "2026-03-28T05:10:43.875482395Z"}
{"id": "fb977008-fca1-4d58-9e12-dc0cf0e719b2", "source": "brain", "text": "\u5185\u955c\u8d85\u58f0 - \u533b\u751f\u4e0e\u79d1\u5ba4 - \u5999\u4f51\u533b\u7597\u56fd\u9645\n\n\u5185\u955c\u8d85\u58f0 - \u533b\u751f\u4e0e\u79d1\u5ba4 - \u5999\u4f51\u533b\u7597\u56fd\u9645\n\u8fd9\u90e8\u5206\u5185\u5bb9\u6ca1\u6709\u82f1\u8bed\u7248\u672c\u3002\n\u8fd9\u90e8\u5206\u5185\u5bb9\u6ca1\u6709\u963f\u62c9\u4f2f\u8bed\u7248\u672c\u3002\nSkip to content\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7684\u533b\u7597\u62a4\u7406\n\u4ee5\u60a3\u8005\u4e3a\u4e2d\u5fc3\u7684\u62a4\u7406\n\u5173\u4e8e\u5999\u4f51\u533b\u7597\u56fd\u9645\n\u7533\u8bf7\u7ea6\u8bca\n\u67e5\u627e\u533b\u751f\n\u9662\u533a\u5730\u70b9\n\u4e34\u5e8a\u8bd5\u9a8c\n\u8054\u7cfb\u652f\u52a9\u56e2\u4f53\n\u60a3\u8005\u4e0e\u8bbf\u5ba2\u6307\u5357\n\u8d26\u5355\u4e0e\u4fdd\u9669\n\u79d1\u5ba4 & \u4e2d\u5fc3\n\u56fd\u9645\u670d\u52a1\n\u8054\u7cfb\u6211\u4eec\n\u60a3\u8005\u4e0e\u8bbf\u5ba2\u6307\u5357\n\u5065\u5eb7\u8d44\u6599\u5e93\n\u75be\u75c5 & \u72b6\u51b5\n\u75c7\u72b6\n\u533b\u5b66\u68c0\u67e5 & \u533b\u7597\u7a0b\u5e8f\n\u836f\u7269 & \u8865\u5145\u5242\n\u5065\u5eb7\u751f\u6d3b\u65b9\u5f0f\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u5065\u5eb7\u901a\u8baf\u548c\u4e66\u7c4d\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u5065\u5eb7\u901a\u8baf\u548c\u4e66\u7c4d\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\u8d44\u6e90\n\u8f6c\u8bca\u60a3\u8005\n\u7ee7\u7eed\u533b\u5b66\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u68c0\u6d4b\n\u89c6\u9891\u4e2d\u5fc3\n\u671f\u520a\u6587\u732e\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u6821\u53cb\u4f1a\n\u7ee7\u7eed\u533b\u5b66\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7814\u7a76\u4e0e\u6559\u80b2\n\u7814\u7a76\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7814\u7a76\u9879\u76ee\n\u7814\u7a76\u578b\u6559\u804c\u5458\u5de5\n\u5b9e\u9a8c\u5ba4\n\u6838\u5fc3\u8bbe\u65bd\n\u4e2d\u5fc3 & \u9879\u76ee\n\u90e8\u95e8 & \u79d1\u5ba4\n\u4e34\u5e8a\u8bd5\u9a8c\n\u673a\u6784\u5ba1\u67e5\u59d4\u5458\u4f1a\n\u535a\u58eb\u540e\u5956\u5b66\u91d1\n\u57f9\u8bad\u8d44\u52a9\u9879\u76ee\n\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u4e0e\u79d1\u5b66\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u751f\u7269\u533b\u5b66\u7814\u7a76\u751f\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u827e\u5229\u514b\u65af\u533b\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u6559\u80b2\u7814\u7a76\u751f\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u536b\u751f\u79d1\u5b66\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u4e13\u4e1a\u7ee7\u7eed\u53d1\u5c55\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u4e0e\u79d1\u5b66\u5b66\u9662\n\u7533\u8bf7\u7ea6\u8bca\n\u6177\u6168\u6350\u8d60\n\u767b\u5f55\n\u641c\u7d22\n\u83dc\u5355\n\u8981\u6c42\u9884\u7ea6\n\u6350\n\u75be\u75c5\u548c\u72b6\u51b5\n\u627e\u533b\u751f\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7684\u533b\u7597\u62a4\u7406\n\u4ee5\u60a3\u8005\u4e3a\u4e2d\u5fc3\u7684\u62a4\u7406\n\u5173\u4e8e\u5999\u4f51\u533b\u7597\u56fd\u9645\n\u7533\u8bf7\u7ea6\u8bca\n\u67e5\u627e\u533b\u751f\n\u9662\u533a\u5730\u70b9\n\u4e34\u5e8a\u8bd5\u9a8c\n\u8054\u7cfb\u652f\u52a9\u56e2\u4f53\n\u60a3\u8005\u4e0e\u8bbf\u5ba2\u6307\u5357\n\u8d26\u5355\u4e0e\u4fdd\u9669\n\u79d1\u5ba4 & \u4e2d\u5fc3\n\u56fd\u9645\u670d\u52a1\n\u8054\u7cfb\u6211\u4eec\n\u5173\u4e8e\u6885\u5965\u8bca\u6240\n\u5065\u5eb7\u8d44\u6599\u5e93\n\u75be\u75c5 & \u72b6\u51b5\n\u75c7\u72b6\n\u533b\u5b66\u68c0\u67e5 & \u533b\u7597\u7a0b\u5e8f\n\u836f\u7269 & \u8865\u5145\u5242\n\u5065\u5eb7\u751f\u6d3b\u65b9\u5f0f\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u5065\u5eb7\u901a\u8baf\u548c\u4e66\u7c4d\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u5065\u5eb7\u901a\u8baf\u548c\u4e66\u7c4d\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\u8d44\u6e90\n\u8f6c\u8bca\u60a3\u8005\n\u7ee7\u7eed\u533b\u5b66\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u68c0\u6d4b\n\u89c6\u9891\u4e2d\u5fc3\n\u671f\u520a\u6587\u732e\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u6821\u53cb\u4f1a\n\u7ee7\u7eed\u533b\u5b66\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7814\u7a76\u4e0e\u6559\u80b2\n\u7814\u7a76\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7814\u7a76\u9879\u76ee\n\u7814\u7a76\u578b\u6559\u804c\u5458\u5de5\n\u5b9e\u9a8c\u5ba4\n\u6838\u5fc3\u8bbe\u65bd\n\u4e2d\u5fc3 & \u9879\u76ee\n\u90e8\u95e8 & \u79d1\u5ba4\n\u4e34\u5e8a\u8bd5\u9a8c\n\u673a\u6784\u5ba1\u67e5\u59d4\u5458\u4f1a\n\u535a\u58eb\u540e\u5956\u5b66\u91d1\n\u57f9\u8bad\u8d44\u52a9\u9879\u76ee\n\u6559\u80b2\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u4e0e\u79d1\u5b66\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u751f\u7269\u533b\u5b66\u7814\u7a76\u751f\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u827e\u5229\u514b\u65af\u533b\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u6559\u80b2\u7814\u7a76\u751f\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u536b\u751f\u79d1\u5b66\u5b66\u9662\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u4e13\u4e1a\u7ee7\u7eed\u53d1\u5c55\u5b66\u9662\n\u6885\u5965\u8bca\u6240\u533b\u5b66\u4e0e\u79d1\u5b66\u5b66\u9662\n\u5411 \u5999\u4f51\u533b\u7597\u56fd\u9645 \u6350\u6b3e\n\u7acb\u523b\u4f38\u51fa\u63f4\u624b\n\u5411 \u5999\u4f51\u533b\u7597\u56fd\u9645 \u6350\u6b3e\n\u5e38\u89c1\u95ee\u7b54\n\u8054\u7cfb\u6211\u4eec\uff0c\u8fdb\u884c\u6350\u52a9\n\u7acb\u523b\u4f38\u51fa\u63f4\u624b\n\u533b\u5b66\u68c0\u67e5\u4e0e\u533b\u7597\u7a0b\u5e8f\n\u5185\u955c\u8d85\u58f0\n\u9884\u7ea6\u95e8\u8bca\n\u5173\u4e8e\n\u533b\u751f\u4e0e\u79d1\u5ba4\n\u5728 Mayo Clinic \u6cbb\u7597\n\u6253\u5370\n\u79d1\u5ba4\u4e0e\u4e13\u5bb6\u95e8\u8bca\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u662f\u7f8e\u56fd\u89c4\u6a21\u6700\u5927\u3001\u7ecf\u9a8c\u6700\u4e30\u5bcc\u7684\u533b\u7597\u673a\u6784\u4e4b\u4e00\uff0c\u5728\u4e9a\u5229\u6851\u90a3\u5dde\u3001\u4f5b\u7f57\u91cc\u8fbe\u5dde\u548c\u660e\u5c3c\u82cf\u8fbe\u5dde\u90fd\u8bbe\u6709\u9662\u533a\u3002\u6211\u4eec\u7684\u5de5\u4f5c\u4eba\u5458\u6d89\u53ca\u6570\u5341\u79cd\u4e13\u4e1a\uff0c\u901a\u8fc7\u9f50\u5fc3\u534f\u529b\u786e\u4fdd\u9ad8\u54c1\u8d28\u6cbb\u7597\u4e0e\u6210\u529f\u5eb7\u590d\u3002\n\u6709\u76f8\u5173\u4e13\u957f\u7684\u79d1\u5ba4\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7684\u764c\u75c7\u62a4\u7406\n\u5c0f\u513f\u8840\u6db2\u79d1/\u80bf\u7624\u79d1\n\u65e9\u53d1\u6027\u548c\u9057\u4f20\u6027\u6d88\u5316\u9053\u764c\u75c7\u9879\u76ee\n\u65e9\u53d1\u6027\u7ed3\u76f4\u80a0\u764c\u5c0f\u7ec4\n\u7f57\u5207\u65af\u7279\u9662\u533a\u521b\u4f24\u3001\u91cd\u75c7\u533b\u62a4\u548c\u666e\u5916\u79d1\n\u80c3\u80a0\u75c5\u79d1\u548c\u809d\u75c5\u79d1\n\u884c\u6b64\u624b\u672f\u7684\u533b\u751f\n\u7f16\u8f91\u641c\u7d22\u8fc7\u6ee4\u6761\u4ef6\nclose\n\u7f29\u5c0f\u641c\u7d22\u8303\u56f4\n\u6839\u636e\u5730\u70b9\n\u4e9a\u5229\u6851\u90a3\u5dde\u51e4\u51f0\u57ce/\u65af\u79d1\u8328\u4ee3\u5c14\n\u6309\u59d3\u6c0f\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f A A\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f B B\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f C C\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f D D\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f E E\n\u4e3b\u52a8 \u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f F F\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f G G\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f H H\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f I I\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f J J\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f K K\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f L L\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f M M\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f N N\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f O O\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f P P\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f Q Q\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f R R\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f S S\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f T T\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f U U\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f V V\n\u67e5\u627e\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f W W\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f X X\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f Y Y\n\u672a\u627e\u5230\u59d3\u6c0f\u4ee5\u8be5\u5b57\u6bcd\u5f00\u5934\u7684\u533b\u751f Z Z\n\u91cd\u7f6e\u6240\u6709\u8fc7\u6ee4\u5668\n\u641c\u7d22\u63d0\u793a\n\u7ed9\u641c\u7d22\u8bcd\u52a0\u5f15\u53f7\u3002\n\u5373\u4f7f\u641c\u7d22\u680f\u6ca1\u6709\u663e\u793a\u81ea\u52a8\u5efa\u8bae\uff0c\u4e5f\u8bf7\u70b9\u51fb\u201c\u641c\u7d22\u201d\uff0c\u60a8\u6216\u8bb8\u4ecd\u7136\u53ef\u4ee5\u83b7\u5f97\u7ed3\u679c\u3002\n\u663e\u793a$\u8d77\u59cb\u8303\u56f4 - $\u7ed3\u675f\u8303\u56f4/\u6e90\u81ea\u53ef\u7528$\u53ef\u7528\u533b\u751f\n\u59d3\u6c0f\u9996\u5b57\u6bcd: F\nDouglas O. Faigel, M.D.\nGastroenterologist\nPhoenix, AZ\n\u64c5\u957f\u9886\u57df\uff1a\nColonoscopy, Upper endoscopy, Endoscopic ultrasound, ERCP, Double balloon enteroscopy, Pancreatic cancer, Gastroesophag...eal reflux disease, Pancreatic cyst, Esophageal cancer, Colon polyps, Stomach cancer, Rectal cancer, Pancreatic neuroendocrine tumor, Pancreatitis, Stomach polyps, Gastrointestinal bleeding, Rectal neuroendocrine tumor, Esophageal stricture, Bile duct injury, Bile duct cyst, Gastric outlet obstruction, Bile duct stricture, Bile duct stone, Mediastinal lymph node enlargement, Mediastinal tumor\n\u663e\u793a\u66f4\u591a\u64c5\u957f\u9886\u57df \u9488\u5bf9 Douglas O. Faigel, M.D.\n\u7814\u7a76\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u7684\u7814\u7a76\u4eba\u5458\u6b63\u5728\u52aa\u529b\u6539\u8fdb\u5185\u955c\u8d85\u58f0\u68c0\u67e5\uff0c\u5e76\u8fdb\u4e00\u6b65\u63a2\u7d22\u8be5\u6280\u672f\u7684\u5e94\u7528\u3002\u5176\u4e2d\u5305\u62ec\u5229\u7528\u5185\u955c\u8d85\u58f0\u6765\u68c0\u67e5\u662f\u5426\u6709\u764c\u524d\u75c5\u53d8\uff0c\u4f8b\u5982\u5df4\u96f7\u7279\u98df\u7ba1\u75c7\u7684\u5206\u671f\u548c\u6cbb\u7597\uff0c\u4ee5\u53ca\u5bf9\u98df\u7ba1\u764c\u548c\u80f0\u817a\u764c\u8fdb\u884c\u6cbb\u7597\u3002\u4e86\u89e3\u66f4\u591a\u5173\u4e8e\u5999\u4f51\u533b\u7597\u56fd\u9645\u80c3\u80a0\u75c5\u5b66\u548c\u809d\u75c5\u5b66\u79d1\u4ee5\u53ca\u547c\u5438\u4e0e\u5371\u91cd\u75c7\u533b\u5b66\u79d1\u7684\u7814\u7a76\u7684\u4fe1\u606f\u3002\n\u6587\u732e\n\u8bf7\u53c2\u9605\u7f8e\u56fd\u56fd\u5bb6\u533b\u5b66\u56fe\u4e66\u9986\u68c0\u7d22\u670d\u52a1\u7cfb\u7edf PubMed \u6240\u6536\u5f55\u7684\u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u751f\u5728\u5185\u955c\u8d85\u58f0\u9886\u57df\u7684\u6587\u732e\u76ee\u5f55\u3002\n\u6765\u81ea\u5999\u4f51\u533b\u7597\u56fd\u9645\u5458\u5de5\n\u5728 Mayo Clinic \u6cbb\u7597\n\u7533\u8bf7\u9884\u7ea6\n\u5173\u4e8e\u5728 Mayo Clinic \u6cbb\u7597\nFeb. 21, 2025\n\u6253\u5370\n\u663e\u793a\u53c2\u8003\u6587\u732e\nUnderstanding EUS (endoscopic ultrasonography). Amerian Society for Gastrointestinal Endoscopy. https://www.asge.org<PATH_1> Accessed Feb. 11, 2024.\nGress FG, et al. Endoscopic ultrasound: Examination of the upper gastrointestinal tract. https://www.uptodate.com/contents/search. Accessed Feb. 11, 2024.\nWiersema MJ. Endoscopic ultrasound-guided fine needle aspiration in the gastrointestinal tract. https://www.uptodate.com/contents/search. Accessed Feb. 11, 2024.\nFasanella KE, et al. Therapeutic endoscopic ultrasound. https://www.uptodate.com/contents/search. Accessed Feb. 11, 2024.\nForbes N, et al. Adverse events associated with EUS and EUS-guided procedures. Gastrointestinal Endoscopy. 2022; doi:10.1016/j.gie.2021.09.009.\nMedical review (expert opinion). Mayo Clinic. April 20, 2022.\nAmi TR. Allscripts EPSi. Mayo Clinic. April 17, 2024.\n\u76f8\u5173\n\u5353\u827e\u7efc\u5408\u5f81\n\u80f0\u817a\u56ca\u80bf\n\u80f0\u817a\u708e\n\u80f0\u817a\u764c\n\u663e\u793a\u66f4\u591a\u76f8\u5173\u5185\u5bb9\n\u4ea7\u54c1\u4e0e\u670d\u52a1\n\u4e66\u7c4d\uff1a\u300a\u5999\u4f51\u533b\u7597\u56fd\u9645\u5bb6\u5ead\u5065\u5eb7\u624b\u518c\u300b\n\u7b80\u62a5\uff1a\u5999\u4f51\u533b\u7597\u56fd\u9645\u536b\u751f\u6765\u4fe1 \u2014 \u6570\u5b57\u7248\n\u663e\u793a\u66f4\u591a\u6765\u81ea\u5999\u4f51\u533b\u7597\u56fd\u9645\u7684\u4ea7\u54c1\u548c\u670d\u52a1\n\u5185\u955c\u8d85\u58f0\n\u5173\u4e8e\n\u533b\u751f\u4e0e\u79d1\u5ba4\n\u5728 Mayo Clinic \u6cbb\u7597\nPRC-20305534\n\u533b\u5b66\u68c0\u67e5\u4e0e\u533b\u7597\u7a0b\u5e8f\n\u5185\u955c\u8d85\u58f0\n\u4e00\u4efd\u9988\u8d60\uff0c\u65e0\u7a77\u529b\u91cf\u2014\u2014\u4eca\u5929\u5c31\u6765\u4f38\u51fa\u63f4\u624b\uff01\n\u6177\u6168\u6350\u8d60\n\u60a8\u7684\u6350\u8d60\u53ef\u4ee5\u62b5\u7a0e\u3002\u8bf7\u60a8\u6177\u6168\u89e3\u56ca\uff0c\u548c\u6211\u4eec\u4e00\u8d77\u8fdb\u884c\u5c16\u7aef\u7814\u7a76\u548c\u533b\u62a4\uff0c\u5171\u540c\u63a8\u52a8\u533b\u5b66\u7684\u6539\u53d8\u3002\n\u6177\u6168\u6350\u8d60\n\u67e5\u627e\u533b\u751f\n\u67e5\u8be2\u804c\u4f4d\n\u8ba2\u9605\u7535\u5b50\u65b0\u95fb\u7b80\u8baf\n\u5173\u4e8e\u5999\u4f51\u533b\u7597\u56fd\u9645\n\u5173\u4e8e\u7f51\u7ad9\n\u8054\u7cfb\u6211\u4eec\n\u9662\u533a\u5730\u70b9\n\u5065\u5eb7\u4fe1\u606f\u653f\u7b56\n\u8054\u90a6\u533b\u7597\u4fdd\u9669\u8d23\u4efb\u533b\u7597\u7ec4\u7ec7\uff08ACO\uff09\n\u5a92\u4f53\u5782\u8be2\n\u65b0\u95fb\u7f51\u7edc\n\u4ef7\u683c\u900f\u660e\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\u4e13\u533a\nAskMayoExpert\n\u4e34\u5e8a\u8bd5\u9a8c\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u6821\u53cb\u4f1a\n\u8f6c\u8bca\u60a3\u8005\n\u5546\u52a1\u4e13\u533a\n\u9ad8\u7ba1\u5065\u5eb7\u9879\u76ee\n\u56fd\u9645\u4e1a\u52a1\u5408\u4f5c\n\u8bbe\u65bd & \u623f\u5730\u4ea7\n\u4f9b\u5e94\u5546\u4fe1\u606f\n\u533b\u7597\u4e13\u4e1a\u4eba\u5458\u4e13\u533a\nAskMayoExpert\n\u4e34\u5e8a\u8bd5\u9a8c\n\u5999\u4f51\u533b\u7597\u56fd\u9645\u6821\u53cb\u4f1a\n\u8f6c\u8bca\u60a3\u8005\n\u5546\u52a1\u4e13\u533a\n\u9ad8\u7ba1\u5065\u5eb7\u9879\u76ee\n\u56fd\u9645\u4e1a\u52a1\u5408\u4f5c\n\u8bbe\u65bd & \u623f\u5730\u4ea7\n\u4f9b\u5e94\u5546\u4fe1\u606f\n\u5b66\u751f\u4e13\u533a\n\u5165\u5b66\u8981\u6c42\n\u5b66\u4f4d\u9879\u76ee\n\u5b66\u751f\u4e0e\u6559\u5458\u95e8\u6237\u7f51\u7ad9\n\u5b66\u751f\u4e13\u533a\n\u5b66\u4f4d\u9879\u76ee\n\u5165\u5b66\u8981\u6c42\n\u5b66\u751f\u4e0e\u6559\u5458\u95e8\u6237\u7f51\u7ad9\n\u7814\u7a76\u4eba\u5458\u4e13\u533a\n\u6559\u7814\u4eba\u5458\n\u5b9e\u9a8c\u5ba4\n\u56fd\u9645\u60a3\u8005\u4e13\u533a\n\u7ea6\u8bca\n\u8d22\u52a1\u670d\u52a1\n\u56fd\u9645\u670d\u52a1\u5730\u70b9 & \u529e\u4e8b\u5904\n\u6148\u5584\u62a4\u7406 & \u8d22\u52a1\u63f4\u52a9\n\u793e\u533a\u5065\u5eb7\u9700\u6c42\u8bc4\u4f30\n\u8d22\u52a1\u63f4\u52a9\u6587\u4ef6 - \u4e9a\u5229\u6851\u90a3\u5dde\n\u8d22\u52a1\u63f4\u52a9\u6587\u4ef6 - \u4f5b\u7f57\u91cc\u8fbe\u5dde\n\u8d22\u52a1\u63f4\u52a9\u6587\u4ef6 - \u660e\u5c3c\u82cf\u8fbe\u5dde\n\u5173\u6ce8\u5999\u4f51\u533b\u7597\u56fd\u9645\nX\nFacebook\nYouTube\nWeibo\n\u4e0b\u8f7d\u5999\u4f51\u533b\u7597\u56fd\u9645\u5e94\u7528\u7a0b\u5e8f\n\u6761\u4f8b\u6761\u6b3e\n\u9690\u79c1\u6743\u653f\u7b56\n\u9690\u79c1\u60ef\u4f8b\u58f0\u660e\n\u65e0\u6b67\u89c6\u58f0\u660e\n\u65e0\u969c\u788d\u8bbf\u95ee\u58f0\u660e\n\u5e7f\u544a & \u8d5e\u52a9\u653f\u7b56\n\u7f51\u7ad9\u5bfc\u822a\n\u7ba1\u7406 Cookies\n\u6761\u4f8b\u6761\u6b3e\n\u9690\u79c1\u6743\u653f\u7b56\n\u9690\u79c1\u60ef\u4f8b\u58f0\u660e\n\u65e0\u6b67\u89c6\u58f0\u660e\n\u65e0\u969c\u788d\u8bbf\u95ee\u58f0\u660e\n\u5e7f\u544a & \u8d5e\u52a9\u653f\u7b56\n\u7f51\u7ad9\u5bfc\u822a\n\u7ba1\u7406 Cookies\n\u8bed\u8a00:\n\u7b80\u4f53\u4e2d\u6587\nEnglish\nEspa\u00f1ol\n\u0627\u0644\u0639\u0631\u0628\u064a\u0629\n\u7b80\u4f53\u4e2d\u6587\n\u00a9 1998-2026 \u5999\u4f51\u533b\u7597\u56fd\u9645\u533b\u5b66\u6559\u80b2\u4e0e\u7814\u7a76\u57fa\u91d1\u4f1a \uff08MFMER\uff09\u3002\u4fdd\u7559\u6240\u6709\u6743\u5229\u3002\n\u8bed\u8a00:\n\u7b80\u4f53\u4e2d\u6587\nEnglish\nEspa\u00f1ol\n\u0627\u0644\u0639\u0631\u0628\u064a\u0629\n\u7b80\u4f53\u4e2d\u6587", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fb977008-fca1-4d58-9e12-dc0cf0e719b2", "content_hash": "3d568fffcfb3a3a1b81e3c61088e775f7a773c069f12254097d8a21584228442", "created_at": "2026-03-28T05:10:43.770774565Z"}
{"id": "80160f04-edb8-44eb-bbe4-ec61e02fbb93", "source": "brain", "text": "\u0627\u0644\u0623\u0637\u0628\u0627\u0621 \u0648\u0627\u0644\u0623\u0642\u0633\u0627\u0645 - Mayo Clinic (\u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643)\n\n\u0627\u0644\u0623\u0637\u0628\u0627\u0621 \u0648\u0627\u0644\u0623\u0642\u0633\u0627\u0645 - Mayo Clinic (\u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643)\n\u0641\u063a\u0631 \u0627\u0644\u0631\u063a\u0627\u0645\u064a\n\u0627\u0644\u0628\u062d\u062b\n\u064a\u062f\u0631\u0633 \u0627\u062e\u062a\u0635\u0627\u0635\u064a\u0648 \u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643 \u0627\u0644\u0646\u062a\u0627\u0626\u062c \u0627\u0644\u0648\u0638\u064a\u0641\u064a\u0629 \u0637\u0648\u064a\u0644\u0629 \u0627\u0644\u0623\u062c\u0644 \u0641\u064a \u0627\u0644\u0623\u0634\u062e\u0627\u0635 \u0627\u0644\u0630\u064a\u0646 \u0623\u0635\u064a\u0628\u0648\u0627 \u0628\u0633\u0643\u062a\u0629 \u062f\u0645\u0627\u063a\u064a\u0629 \u0648\u0623\u062c\u0631\u0648\u0627 \u062b\u0642\u0628 \u0627\u0644\u0642\u0635\u0628\u0629 \u0627\u0644\u0647\u0648\u0627\u0626\u064a\u0629 \u0627\u0644\u0645\u0628\u0643\u0631\u060c \u0645\u0642\u0627\u0631\u0646\u0629\u064b \u0628\u0627\u0644\u0630\u064a\u0646 \u0627\u0633\u062a\u062e\u062f\u0645\u0648\u0627 \u0623\u0646\u0627\u0628\u064a\u0628 \u0627\u0644\u062a\u0646\u0641\u0633 \u0627\u0644\u0645\u0648\u0636\u0648\u0639\u0629 \u0641\u064a \u0627\u0644\u0642\u0635\u0628\u0629 \u0627\u0644\u0647\u0648\u0627\u0626\u064a\u0629 \u0639\u0628\u0631 \u0627\u0644\u0641\u0645 \u0644\u0641\u062a\u0631\u0629 \u0637\u0648\u064a\u0644\u0629\u060c \u0627\u0644\u0645\u0639\u0631\u0648\u0641\u0629 \u0623\u064a\u0636\u064b\u0627 \u0628\u0627\u0633\u0645 \u0627\u0644\u062a\u0646\u0628\u064a\u0628 \u0627\u0644\u0641\u0645\u0648\u064a \u0627\u0644\u0631\u0651\u064f\u063a\u0627\u0645\u064a.\n\u0627\u0644\u0645\u0646\u0634\u0648\u0631\u0627\u062a\n\u0627\u0637\u0651\u064e\u0644\u0650\u0639\u0652 \u0639\u0644\u0649 \u0642\u0627\u0626\u0645\u0629 \u0627\u0644\u0645\u0646\u0634\u0648\u0631\u0627\u062a \u062d\u0648\u0644 \u0627\u0644\u0641\u063a\u0631 \u0627\u0644\u0631\u063a\u0627\u0645\u064a \u0627\u0644\u062a\u064a \u0623\u0639\u062f\u0651\u064e\u0647\u0627 \u0623\u0637\u0628\u0627\u0621 Mayo Clinic \u0639\u0644\u0649 \u0645\u0646\u0635\u0629 PubMed\u060c \u0648\u0647\u064a \u062e\u062f\u0645\u0629 \u062a\u0627\u0628\u0639\u0629 \u0644\u0644\u0645\u0643\u062a\u0628\u0629 \u0627\u0644\u0648\u0637\u0646\u064a\u0629 \u0644\u0644\u0637\u0628.\n\u0645\u0646 \u0625\u0639\u062f\u0627\u062f \u0641\u0631\u064a\u0642 \u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643\n.\nMayo Clinic Footer\nLegal Conditions and Terms\n\u064a\u0645\u062b\u0644 \u0623\u064a \u0627\u0633\u062a\u062e\u062f\u0627\u0645 \u0644\u0647\u0630\u0627 \u0627\u0644\u0645\u0648\u0642\u0639 \u0627\u0644\u0625\u0644\u064a\u0643\u062a\u0631\u0648\u0646\u064a \u0645\u0648\u0627\u0641\u0642\u062a\u0643 \u0639\u0644\u0649 \u0627\u0644\u0623\u062d\u0643\u0627\u0645 \u0648\u0627\u0644\u0634\u0631\u0648\u0637 \u0648\u0633\u064a\u0627\u0633\u0629 \u0627\u0644\u062e\u0635\u0648\u0635\u064a\u0629 \u0641\u064a \u0627\u0644\u0631\u0627\u0628\u0637 \u0627\u0644\u0625\u0644\u064a\u0643\u062a\u0631\u0648\u0646\u064a \u0623\u062f\u0646\u0627\u0647.\n\u0627\u0644\u0634\u0631\u0648\u0637 \u0648\u0627\u0644\u0623\u062d\u0643\u0627\u0645\n\u0633\u064a\u0627\u0633\u0629 \u0627\u0644\u062e\u0635\u0648\u0635\u064a\u0629\n\u0625\u0634\u0639\u0627\u0631 \u0628\u0645\u0645\u0627\u0631\u0633\u0627\u062a \u0627\u0644\u062e\u0635\u0648\u0635\u064a\u0629\n\u0644\u062a\u062f\u0628\u064a\u0631 \u0645\u0644\u0641\u0627\u062a \u062a\u0639\u0631\u064a\u0641 \u0627\u0644\u0627\u0631\u062a\u0628\u0627\u0637\nAdvertising\n\u062a\u0639\u062a\u0628\u0631 Mayo Clinic [\u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643] \u0645\u0646\u0638\u0645\u0629 \u063a\u0628\u0631 \u0631\u0628\u062d\u064a\u0629\u060c \u0625\u0630 \u062a\u0641\u064a\u062f \u0625\u064a\u0631\u0627\u062f\u0627\u062a \u0627\u0644\u0625\u0639\u0644\u0627\u0646 \u0639\u0644\u0649 \u0627\u0644\u0634\u0628\u0643\u0629 \u0641\u064a \u062f\u0639\u0645 \u0631\u0633\u0627\u0644\u062a\u0646\u0627. \u0644\u0627 \u062a\u064f\u0635\u0627\u062f\u0642 Mayo Clinic [\u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643] \u0639\u0644\u0649 \u0645\u0646\u062a\u062c\u0627\u062a \u0627\u0644\u062c\u0647\u0629 \u0627\u0644\u062b\u0627\u0644\u062b\u0629 \u0623\u0648 \u0627\u0644\u062e\u062f\u0645\u0627\u062a \u0627\u0644\u062a\u064a \u064a\u062a\u0645 \u0627\u0644\u0625\u0639\u0644\u0627\u0646 \u0639\u0646\u0647\u0627. Mayo Clinic [\u0645\u0627\u064a\u0648 \u0643\u0644\u064a\u0646\u0643] \u0645\u0646\u0638\u0645\u0629 \u063a\u064a\u0631 \u0631\u0628\u062d\u064a\u0629. \u0642\u0645 \u0628\u0627\u0644\u062a\u0628\u0631\u0639.\n\u0633\u064a\u0627\u0633\u0629 \u0627\u0644\u0625\u0639\u0644\u0627\u0646 \u0648\u0627\u0644\u0631\u0639\u0627\u064a\u0629\n\u0641\u0631\u0635 \u0644\u0644\u0625\u0639\u0644\u0627\u0646 \u0648\u0627\u0644\u0631\u0639\u0627\u064a\u0629\nReprint Permissions\n\u0645\u0624\u0633\u0633\u0629 \u0645\u0627\u064a\u0648 \u0644\u0644\u062a\u0639\u0644\u064a\u0645 \u0648\u0627\u0644\u0628\u062d\u062b \u0627\u0644\u0637\u0628\u064a. \u062c\u0645\u064a\u0639 \u0627\u0644\u062d\u0642\u0648\u0642 \u0645\u062d\u0641\u0648\u0638\u0629. \u064a\u064f\u0645\u0643\u0646 \u0625\u0639\u0627\u062f\u0629 \u0637\u0628\u0627\u0639\u0629 \u0646\u0633\u062e\u0629 \u0648\u0627\u062d\u062f\u0629 \u0645\u0646 \u0647\u0630\u0647 \u0627\u0644\u0645\u0648\u0627\u062f \u0644\u063a\u0631\u0636 \u0627\u0644\u0627\u0633\u062a\u0639\u0645\u0627\u0644 \u0627\u0644\u0634\u062e\u0635\u064a \u063a\u064a\u0631 \u0627\u0644\u062a\u062c\u0627\u0631\u064a \u0641\u062d\u0633\u0628. \u062a\u062a\u0636\u0645\u0646 \u0627\u0644\u0639\u0644\u0627\u0645\u0627\u062a \u0627\u0644\u062a\u062c\u0627\u0631\u064a\u0629 \u0627\u0644\u062a\u0627\u0628\u0639\u0629 \u0644\u0645\u0624\u0633\u0633\u0629 Mayo Clinic \u0644\u0644\u062a\u0639\u0644\u064a\u0645 \u0648\u0627\u0644\u0628\u062d\u062b \u0627\u0644\u0637\u0628\u064a: Mayo Clinic\"\u0648 \"Mayo\" \u0648\"MayoClinic.com\" \u0648\"EmbodyHealth\" \u0648\u0627\u0644\u0631\u0645\u0632 \u062b\u0644\u0627\u062b\u064a \u0627\u0644\u062f\u064f\u0631\u0648\u0639 \u0627\u0644\u062a\u0627\u0628\u0639 \u0644\u0640 Mayo Clinic.\n\u00a9 1998-2026 Mayo Foundation for Medical Education and Research (MFMER). All rights reserved.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/80160f04-edb8-44eb-bbe4-ec61e02fbb93", "content_hash": "868d4189da987f3111c9997aceeaffaa97e8fe4abdec96ef6e5cf4030fa34b47", "created_at": "2026-03-28T05:10:43.666469101Z"}
{"id": "cfc4b18d-1ac9-4fe8-bda5-8cf7e821b021", "source": "brain", "text": "Marine Lantern, Solar Marine dan Lampu-lampu Navigasi Kelautan.: NEW I :Kap Lampu TIDELAND MARINE NAVIGATIONAL BUOY LANTERN BEACON ML-155, Lampu Na...\n\nMarine Lantern, Solar Marine dan Lampu-lampu Navigasi Kelautan.: NEW I :Kap Lampu TIDELAND MARINE NAVIGATIONAL BUOY LANTERN BEACON ML-155, Lampu Navigasi Maxlumina marine Lantern\nMarine Lantern, Solar Marine dan Lampu-lampu Navigasi Kelautan.\nSunergy Indonesia adalah sebuah usaha yang mengkhususkan diri bergerak dalam penjualan Marine Lantern, Solar Marine dan Lampu-lampu Navigasi Kelautan. Untuk Pemesanan/order Silahkan Tlp/sms/WA ke: 0896-2049-5107 atau email ke: <EMAIL_12> atau <EMAIL_13>\nSelasa, 07 Oktober 2025\nNEW I :Kap Lampu TIDELAND MARINE NAVIGATIONAL BUOY LANTERN BEACON ML-155, Lampu Navigasi Maxlumina marine Lantern\nAlamat Kami :SUNERGY INDONESIA , Alamat : Kedungwinangun Rt 02 Rw 07 Pedana, Kec. Klirong, Kab. Kebumen. Jawa Tengah 54381 Tlp: 0896-2049-5107 Indonesia\nUntuk Pemesanan/order Silahkan Tlp/sms/WA ke: 0896-2049-5107 atau email ke: <EMAIL_12> atau <EMAIL_13>\napprox dims:\nML-155 has a 155 millimeter lens, about 6 inches in diameter.\nTOTAL height is just over 19\"\nof which 7.5\" is the gray base with the colored lens being nearly a foot tall.\nGreatest total \"width\" is at the center where the halves meet: including the hinge protrusions, about 10\".\nThese Lanterns are New Stock\ndiposting oleh SUNERGY INDONESIA @ Oktober 07, 2025 0 Komentar\n0 Komentar:\nPosting Komentar\nBerlangganan Posting Komentar [Atom]\n<< Beranda\nMengenai Saya\nNama: SUNERGY INDONESIA\nLokasi: Kedungwinangun Rt 02 Rw 07 Pedana, Kec. Klirong, Kab. Kebumen. Jawa Tengah 54381 Tlp: 0896-2049-5107, Indonesia\nSunergy Indonesia adalah sebuah usaha yang mengkhususkan diri bergerak dalam penjualan Marine Lantern, Solar Marine dan Lampu-lampu Navigasi Kelautan. Untuk Pemesanan/order Silahkan Tlp/sms/WA ke: 0896-2049-5107 atau email ke: <EMAIL_12> atau <EMAIL_13> Alamat Kami :SUNERGY INDONESIA , Alamat : Kedungwinangun Rt 02 Rw 07 Pedana, Kec. Klirong, Kab. Kebumen. Jawa Tengah 54381 Tlp: 0896-2049-5107 Indonesia\nLihat profil lengkapku\nPostingan Sebelumnya\nwealth marine Radar Beacon RACON\nVEGA Marine Beacon VLB-5X\n3-5NM+ Solar Self Contained Marine Lantern SL-C310...\n5\u20139NM+ Stand Alone Marine Lanterns Sealite SL-125 ...\nCarmanah M650 : 4 - 6 NM / Solar Marine Lantern (...\nMorningstar Corporation SunSaver 12V, 10A Charge C...\nTIDELAND ML-300 MAXLUMINA\u00ae MARINE SIGNAL LANTERN\nLampu Pharos FA\u2010249 Marine Lantern\nRokem Radar Beacon RACON\nEnersys Cyclon\nBerlangganan\nKomentar [Atom]", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/cfc4b18d-1ac9-4fe8-bda5-8cf7e821b021", "content_hash": "039760190fc55e2257b875a9abfc38771c9bdd4365edfd6f12afc858b3a8e135", "created_at": "2026-03-28T05:10:43.583490945Z"}
{"id": "596bc73e-4615-4003-a9eb-8c4aeb11f974", "source": "brain", "text": "Kada sam videla s kim se moj mu\u017e tajno dopisuje celo telo mi se treslo: A onda mi je on otkrio istinu koju ni u najlu\u0111im snovima nisam mogla da zam...\n\nKada sam videla s kim se moj mu\u017e tajno dopisuje celo telo mi se treslo: A onda mi je on otkrio istinu koju ni u najlu\u0111im snovima nisam mogla da zamislim | Brze i provjerene vijesti\nPo\u010detna\nNovo\nRegion\nDom i vrt\nRecepti\nSavjeti\nShowbizz\nZdravlje\nSearch\nFriday, February 6, 2026\nPo\u010detna\nO nama\nKontakt\nPravila i uslovi kori\u0161tenja\nPrivacy policy\nBrze i provjerene vijesti\nPo\u010detna\nNovo\nRegion\nDom i vrt\nRecepti\nSavjeti\nShowbizz\nZdravlje\nHome Novo Kada sam videla s kim se moj mu\u017e tajno dopisuje celo telo...\nNovo\nRegion\nKada sam videla s kim se moj mu\u017e tajno dopisuje celo telo mi se treslo: A onda mi je on otkrio istinu koju ni u najlu\u0111im snovima nisam mogla da zamislim\nBy\nRedakcija\n-\nAugust 13, 2025\n450\n0\nShare\nFacebook\nTwitter\nGoogle+\nPinterest\nWhatsApp\nU dana\u0161nnjem \u010dlanku \u017eelim da podelim pri\u010du koja po\u010dinje kao bajka, ali se ubrzo pretvorila u niz neo\u010dekivanih doga\u0111aja koji su moj \u017eivot potpuno promenili. Moj mu\u017e i ja smo zajedno ve\u0107 tri godine, a u braku \u0161est meseci.\nSmatrala sam ga savr\u0161nim partnerom, \u010dovekom kakvog sam oduvek \u017eelela, i verovala sam da \u017eivim svoj san. Me\u0111utim, ono \u0161to je trebalo da bude mirno i sre\u0107no razdoblje, odjednom je po\u010delo da se ru\u0161i pred mojim o\u010dima.\nSve je po\u010delo tokom jednog putovanja kolima. Nakon dva sata vo\u017enje, stali smo da sipamo benzin i kupimo neke grickalice. Moj mu\u017e je iza\u0161ao iz automobila, a ja sam ostala sama. Tada sam primetila da je njegov telefon ostao u autu i da je stigla notifikacija sa Instagrama, \u0161to me je zbunilo jer mi je ranije rekao da nema nalog i da ga ne \u017eeli. Radoznalost me je nadvladala, pa sam uzela telefon i pro\u010ditala poruku koju je primio.\nTada je po\u010dela moja unutra\u0161nja agonija. Poruke su sadr\u017eale re\u010denice poput: \u201cVolim te\u201d i \u201cJedva \u010dekam da te vidim\u201d, a on je komentarisao slike devojke re\u010dima poput \u201cprelepa si\u201d. I dok bi svaka supruga u tom trenutku osetila bol zbog sumnje u neveru, ono \u0161to me je najvi\u0161e \u0161okiralo bio je uzrast osobe kojoj su poruke upu\u0107ene \u2013 samo 15, 16 godina.\nSrce mi je zaledilo. Bacila sam telefon iz ruku i kada se on vratio u auto, pravila sam se da spavam, zatvaraju\u0107i o\u010di dok mi se telo treslo. Morala sam da provedem jo\u0161 \u0161est sati u kolima sa \u010dovekom kojeg sam odjednom po\u010dela da ne poznajem. Jedina uteha bila je \u010dinjenica da smo i\u0161li kod mojih roditelja, gde bih se ose\u0107ala sigurnom.\nNakon dva sata putovanja, zaustavili smo se na parkingu motela. Jeza mi je pro\u0161la celim telom kada je rekao da je bolje da odmorim u pravom krevetu pre nego \u0161to nastavimo put. Po prvi put nisam se ose\u0107ala sigurno pored svog mu\u017ea. Povukla sam se u kupatilo, gde sam provela oko sat vremena, dok me je on molio da mu ka\u017eem \u0161ta nije u redu jer ga moje pona\u0161anje brine.\nNisam vi\u0161e mogla da izdr\u017eim i rekla sam mu sve \u0161to sam saznala. On je odmah po\u010deo da se izvinjava, obja\u0161njavaju\u0107i da je \u017eeleo da mi ka\u017ee istinu u pravom trenutku. Ali ja nisam mogla da prihvatim izvinjenje \u2013 moje misli su bile preplavljene sumnjom i \u0161okom. Nakon nekoliko minuta ti\u0161ine, rekao je da sam sve pogre\u0161no shvatila.\nObjasnio je da je devojka koja mi je izazvala \u0161ok njegova \u0107erka. Pokazao mi je DNK test kao dokaz njihove srodnosti. Rekao je da ga je ona prvi put kontaktirala pre godinu dana preko Facebooka. Nakon nekoliko susreta i DNK testa koji je potvrdio istinu, stvorili su jaku vezu, ali mi tada nismo znali ni\u0161ta jer je bio period priprema za na\u0161u svadbu. Njegova \u0107erka i on nisu \u017eeleli da \u0161ire informacije dok ne budu spremni.\nPri\u010da se komplikuje jer je moj mu\u017e kao tinejd\u017eer bio u vezi sa njenom majkom, koja je iznenada prekinula kontakt. \u0106erka nije znala gde je njen otac, pa su komunicirali samo putem dru\u0161tvenih mre\u017ea dok nije bila spremna da otkrije istinu svojoj majci.\nOtkri\u0107e me je potpuno zateklo. Nisam bila sigurna da li mogu da prihvatim ovu novu realnost i nisam odmah verovala da mi govori istinu. Moj mu\u017e je, shvativ\u0161i moju sumnju, pokazao sve dokaze, uklju\u010duju\u0107i poruke u kojima ga ona naziva \u201ctata\u201d. Suze i izvinjenja su sledile sa obe strane. Iako smo uspeli da razjasnimo nesporazum, ostala su pitanja o budu\u0107nosti na\u0161eg braka.\nDok razmi\u0161ljam o svemu, ne mogu da se ne zapitam kako \u0107e ovaj doga\u0111aj uticati na na\u0161u vezu i da li \u0107emo uspeti da prebrodimo sve izazove i sa\u010duvamo na\u0161 brak. Situacija je i dalje sve\u017ea, ali jedno je sigurno \u2013 istina, koliko god neo\u010dekivana i \u0161okantna, ponekad donosi olak\u0161anje i priliku za novo razumevanje, \u010dak i kada po\u010dinje u obliku sumnje i bola.\nPlease leave this field empty\nPRIRODNI LIJEKOVI\n\u22c6 BESPLATNO ZA TEBE \u22c6\nUpi\u0161i svoj email i preuzmi priru\u010dnik 'Ljekovito bilje'! Nau\u010di tajne prirodnih lijekova i otkrij kako posti\u0107i ravnote\u017eu i zdravlje uz pomo\u0107 \u010dudesnih biljaka.\nJednim klikom preuzmi priru\u010dnik s najboljim prirodnim lijekovima!\nYou\u2019ve been successfully subscribed to our newsletter!\nShare\nFacebook\nTwitter\nGoogle+\nPinterest\nWhatsApp\nPrevious articleZa\u0161to se omek\u0161iva\u010d ne osje\u0107a svaki put kada operete ve\u0161? JER PRAVITE OVU GRE\u0160KU\nNext article\u017dana je \u017eivela u tri veka, jela kg \u010dokolade nedeljno, pu\u0161ila 96 godina i pila vino, a u 114. je snimila i film: Ali svoju dugove\u010dnost pripisala je ovome\nRedakcija\nRELATED ARTICLESMORE FROM AUTHOR\nNovo\nGDJE NA LICU IMATE MLADE\u017d \u2013 SVAKI IMA ZNA\u010cENJE: Odmah prona\u0111ite broj i otkrijte \u0160TA TO GOVORI O VAMA\nNovo\nFEBRUAR DONOSI OGROMNE PROMJENE: Neka se Ribe, \u0160korpija i OVAJ znak pripreme na najuzbudljivije \u017eivotne promjene i preokrete do sad!\nNovo\nMoj sin je spasio \u017eivot starije \u017eene koju je zima gotovo odnela\nNajnovije\nNa\u0161a diva odrasla u siroma\u0161tvu, kao dete pevala na ulici, pa...\nNovember 4, 2024\nEvo kako je izgledao poslednji susret Isidore Bjelice sa ocem: Zbog...\nAugust 9, 2025\nMaja iz Kraljeva je samohrana majka 11 dece: Mu\u017e joj je...\nNovember 22, 2024\n\u017dene \u0161irom Jugoslavije su ludele za njim, a na slikama iz...\nApril 13, 2025\nDa li je obavezno nositi maramu u crkvi? Evo \u0161ta ka\u017ee...\nFebruary 1, 2026\nLoad more\nIzdvojeno\nNovo\nDva meseca je na grobu mu\u017ea vi\u0111ala TU\u0110E cve\u0107e: Pomislila da...\nNovo\n\u201cUzmi sve \u0161to ti \u017eivot pru\u017ea\u201d: Ruski jeromonah o danas najpopularnijoj...\nDom i vrt\nNered u ku\u0107i privla\u010di bedu i siroma\u0161tvo, \u0161to pre o\u010distite ove...\nUncategorized\nDodajte karanfili\u0107 u bebi ulje ZA 1 MINUT BI\u0106ETE \u0160OKIRANI REZULTATOM\nNovo\nVeliki mese\u010dni horoskop za oktobar: Vaga \u0107e uraditi ono \u0161to je...\nNovo\nMislila je da je glavna zvijezda vjen\u010danja \u2013 dok nisam reagovala\nABOUT US\nDobrodo\u0161li na na\u0161 blog. \u017delimo da u\u017eivate u zanimljivom i inspirativnom sadr\u017eaju za sve prilike. Za vas, svakodnevno donosimo zanimljive i korisne informacije iz svijeta i regiona, razli\u010ditih tema od politike do viralnih stvari iz cijelog svijeta.\nContact us: <EMAIL_11>\nFOLLOW US\nPo\u010detna\nO nama\nKontakt\nPravila i uslovi kori\u0161tenja\nPrivacy policy\n\u00a9 Sva prava pridr\u017eana - 2025. - Preno\u0161enje sadr\u017eaja dozvoljeno u OBAVEZNO navo\u0111enje izvora i backlinka na originalni sadr\u017eaj.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/596bc73e-4615-4003-a9eb-8c4aeb11f974", "content_hash": "a19b03892e1a37db075b78b13b08b38aa9ee892b5609920f34b90a789eb95001", "created_at": "2026-03-28T05:10:43.396112716Z"}
{"id": "21a630cf-555d-4454-9a08-2be700edc6c4", "source": "brain", "text": "Electron-impact electronic-state excitation of para-benzoquinone\n\nElectron-impact electronic-state excitation of para-benzoquinone\nElectron-impact electronic-state excitation of para-benzoquinone\nJ Chem Phys. 2018 Mar 28;148(12):124312. doi: 10.1063/1.5023494.\nAuthors\nD B Jones 1 , R F da Costa 2 , F Kossoski 2 , M T do N Varella 3 , M H F Bettega 4 , F Ferreira da Silva 5 , P Lim\u00e3o-Vieira 5 , G Garc\u00eda 6 , M A P Lima 2 , R D White 7 , M J Brunger 1\nAffiliations\n1 College of Science and Engineering, Flinders University, GPO Box 2100, Adelaide, SA 5001, Australia.\n2 Instituto de F\u00edsica \"Gleb Wataghin,\" Universidade Estadual de Campinas, 13083-859 Campinas, S\u00e3o Paulo, Brazil.\n3 Instituto de F\u00edsica, Universidade de S\u00e3o Paulo, Rua do Mat\u00e3o 1731, 05508-090 S\u00e3o Paulo, S\u00e3o Paulo, Brazil.\n4 Departamento de F\u00edsica, Universidade Federal do Paran\u00e1, CP 19044, 81531-990 Curitiba, Paran\u00e1, Brazil.\n5 Laborat\u00f3rio de Colis\u00f5es At\u00f3micas e Moleculares, CEFITEC, Departamento de F\u00edsica, Faculdade de Ci\u00eancias e Tecnologia, Universidade NOVA de Lisboa, 2829-516 Caparica, Portugal.\n6 Instituto de Fisica Fundamental, CSIC, Serrano 113-bis, E-28006 Madrid, Spain.\n7 College of Science and Engineering, James Cook University, Townsville, Australia.\nPMID: 29604872\nDOI: 10.1063/1.5023494\nAbstract\nAngle resolved electron energy loss spectra (EELS) for para-benzoquinone (C6H4O2) have been recorded for incident electron energies of 20, 30, and 40 eV. Measured differential cross sections (DCSs) for electronic band features, composed of a combination of energetically unresolved electronic states, are subsequently derived from those EELS. Where possible, the obtained DCSs are compared with those calculated using the Schwinger multichannel method with pseudopotentials. These calculations were performed using a minimum orbital basis single configuration interaction framework at the static exchange plus polarisation level. Here, quite reasonable agreement between the experimental cross sections and the theoretical cross sections for the summation of unresolved states was observed.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/21a630cf-555d-4454-9a08-2be700edc6c4", "content_hash": "1c32c7d5b8bfd274ae6b145daa5bb3b1e2f8a9652a6af8ae4e8354cf5504656f", "created_at": "2026-03-28T05:10:43.260858632Z"}
{"id": "60c6bf3e-4a86-4cea-9272-2218137e8a07", "source": "brain", "text": "Phenotypic Plasticity: From Theory and Genetics to Current and Future Challenges - PMC\n\nPhenotypic Plasticity: From Theory and Genetics to Current and Future Challenges - PMC\nSkip to main content\nAn official website of the United States government\nHere's how you know\nHere's how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.\nSearch\nLog in\nDashboard\nPublications\nAccount settings\nLog out\nSearch\u2026\nSearch NCBI\nPrimary site navigation\nSearch\nLogged in as:\nDashboard\nPublications\nAccount settings\nLog in\nSearch PMC Full-Text Archive\nSearch in PMC\nJournal List\nUser Guide\nPERMALINK\nCopy\nAs a library, NLM provides access to scientific literature. Inclusion in an NLM database does not imply endorsement of, or agreement with, the contents by NLM or the National Institutes of Health.\nLearn more: PMC Disclaimer | PMC Copyright Notice\nGenetics\n. 2020 Mar 10;215(1):1\u201313. doi: 10.1534/genetics.120.303163\nSearch in PMC\nSearch in PubMed\nView in NLM Catalog\nAdd to search\nPhenotypic Plasticity: From Theory and Genetics to Current and Future Challenges\nRalf J Sommer\nRalf J Sommer\n1Max Planck Institute for Developmental Biology, Department for Integrative Evolutionary Biology, 72076 T\u00fcbingen, Germany\nFind articles by Ralf J Sommer\n1,1\nAuthor information\nArticle notes\nCopyright and License information\n1Max Planck Institute for Developmental Biology, Department for Integrative Evolutionary Biology, 72076 T\u00fcbingen, Germany\n1\nAddress for correspondence: Max Planck Institute for Developmental Biology, Max-Planck Ring 9, 72076 T\u00fcbingen, Germany. E-mail: <EMAIL_10>\nReceived 2019 Nov 29; Accepted 2020 Mar 9; Issue date 2020 May.\nCopyright \u00a9 2020 by the Genetics Society of America\nAvailable freely online through the author-supported open access option.\nPMC Copyright notice\nPMCID: PMC7198268 PMID: 32371438\nPhenotypic plasticity is defined as the property of organisms to produce distinct phenotypes in response to environmental variation. While for more than a century, biologists have proposed this organismal feature...\nKeywords: phenotypic plasticity, polyphenisms, switch genes, plasticity first evolution, canalization, genetic assimilation, genetic accommodation, Pristionchus, Spea, Ontophagus, Manduca\nAbstract\nPhenotypic plasticity is defined as the property of organisms to produce distinct phenotypes in response to environmental variation. While for more than a century, biologists have proposed this organismal feature to play an important role in evolution and the origin of novelty, the idea has remained contentious. Plasticity is found in all domains of life, but only recently has there been an increase in empirical studies. This contribution is intended as a fresh view and will discuss current and future challenges of plasticity research, and the need to identify associated molecular mechanisms. After a brief summary of conceptual, theoretical, and historical aspects, some of which were responsible for confusion and contention, I will formulate three major research directions and predictions for the role of plasticity as a facilitator of novelty. These predictions result in a four-step model that, when properly filled with molecular mechanisms, will reveal plasticity as a major factor of evolution. Such mechanistic insight must be complemented with comparative investigations to show that plasticity has indeed created novelty and innovation. Together, such studies will help develop a true developmental evolutionary biology.\nPHENOTYPIC plasticity is the ability of a genotype to produce different phenotypes in response to distinct environmental conditions (Schlichting and Pigliucci 1998; Pigliucci 2001; West-Eberhard 2003; deWitt and Scheiner 2004; Whitman and Ananthakrishnan 2009; Moczek et al. 2011). Intrinsically, phenotypic plasticity refers to all kinds of environmentally induced phenotypic variation and it can affect morphological, physiological, and behavioral aspects of an organism\u2019s phenotype, but also its life history. Plasticity is a universal property of living things, because all organisms respond to genes and the environment alike; thus, plasticity is found throughout all domains of life. While botanists have long appreciated the environmental influence on plant morphology, plasticity was less valued in animal systems, although it is as widespread in animals as in plants (West-Eberhard 1989). In addition, plasticity is known from bacteria, and even phage \u03bb and other bacteriophages with their lytic (virulent) vs. lysogenic (temperate) life cycles. It is an interesting oddity of the history of biology that the first molecular process that was ever elucidated to near completion, the regulation of the lytic cycle in phage \u03bb, represents an example of plasticity, even though it is rarely discussed as such (Ptashne 2004).\nPlasticity is pervasive, as demonstrated by the many examples currently studied in laboratories around the world. In the interest of space, I will not provide an overview of these study systems as there are simply too many. Instead, I refer the reader to the many review articles that have been published in recent years and that provide excellent overviews (Abouheif et al. 2014; Lande 2014; Laland et al. 2014, 2015; Moczek et al. 2015; Nalepa 2015; Nijhout 2015; Brisson and Davis 2016; Phillips 2016; Susoy and Sommer 2016; Tandonnet and Pires-daSilva 2016; Gibert 2017; Noble et al. 2017; Projecto-Garcia et al. 2017; Reuter et al. 2017; Schneider and Meyer 2017; Serobyan and Sommer 2017; Gilbert 2018; Jones and Robinson 2018; Josephs 2018; Oettler et al. 2018; Sanger and Rajakumar 2018; Sieriebriennikov and Sommer 2018; Uller et al. 2018; Lafuente and Beldade 2019; Levis and Pfennig 2019). While this list contains only those reviews published since 2014 and is likely still incomplete, it demonstrates the growing awareness about plasticity and its evolutionary significance.\nThis growing awareness is in strong contrast to a long phase of neo-Darwinism that neglected the importance of development and the significance of the organism\u2019s responsiveness to the environment for evolution. For example, Williams objected that plasticity guarantees a dead end for the underlying traits, arguing that plasticity hinders evolution (Williams 1966). Similar arguments were made by Charlesworth et al. (1982), disputing the importance of development and the environment in favor of selection as the \u201cmain guiding force of phenotypic evolution\u201d (Charlesworth et al. 1982, p. 474). Such skepticism remained for decades and largely centered around three major reservations (Box 1A) (Wund 2012). First, is there sufficient empirical evidence for plasticity in general, and for plasticity as a driver of evolutionary change? Second, does plasticity act to promote or hinder evolution? Finally, what could be the molecular mechanisms of the environmental influence on phenotypes, how do such mechanisms become genetically encoded, and how do they become a target of selection? These reservations highlighted the fundamental challenges for research on phenotypic plasticity, but they also provided a road map for novel investigations.\nBox 1.\nA: Historical skepticism against phenotypic plasticity and its significance for evolution\n1. Empirical evidence for plasticity?\n2. Can environmental responsiveness promote evolution?\n3. Molecular mechanisms of environmental influence?\nHow should environmental effects be targeted by selection?\nB: Developmental plasticity and evolution - West-Eberhard and four unique contributions for plasticity as a mechanism of evolution\nA giant collection of alternative phenotypes\nAlternative phenotypes as functionally independent targets of selection\nA general critique of Neo-Darwinism and its inconsistencies and gaps\nPlasticity as a facilitator of novelty (The facilitator hypothesis)\nC: ", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/60c6bf3e-4a86-4cea-9272-2218137e8a07", "content_hash": "d1dde5f80e4638a103a66ff0040747d74df2873d939e0d89d3408a2e7dc28fd9", "created_at": "2026-03-28T05:10:43.060279643Z"}
{"id": "1a853491-e0d6-46f5-9a77-41bf29469600", "source": "brain", "text": "NIH VideoCast - 2025 Joram Piatigorsky Basic Science Lecture and Award\n\nNIH VideoCast - 2025 Joram Piatigorsky Basic Science Lecture and Award\nSkip Navigation\nAn official website of the United States government\nHere\u2019s how you know\nHere\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nNIH VideoCasting\nCIT can broadcast your seminar, conference or meeting live to a world-wide audience over the Internet as a real-time streaming video. The event can be recorded and made available for viewers to watch at their convenience as an on-demand video or a downloadable file. CIT can also broadcast NIH-only or HHS-only content.\nVideoCast Home\nPast Events\nUpcoming Events\nFAQ\nContact Us\nTest Computer\nSearch\nhttps://uccwow2.cit.nih.gov/vod\n2025 Joram Piatigorsky Basic Science Lecture and Award\nLoading... Loading video...\n167 Views\n\u00d7\nAir date: Wednesday, April 23, 2025, 3:00:00 PM\nTime displayed is Eastern Time, Washington DC Local\nViews: Total views: 167 (63 Live, 104 On-demand)\nCategory: Special\nRuntime: 01:17:54\nClosed captioning: Check box to display CC outside of the video\nNote: You can drag the captioning window around and resize it\nDescription: Claude Desplan, Ph.D. from New York University, will deliver this year's 2025 Joram Piatigorsky Basic Science Lecture and Award. The lecture will take place on Wednesday, April 23, 2025, from 3:00 PM-4:15 PM at Masur Auditorium, located in the Clinical Center (Building 10) on the NIH campus. It will be followed by a light reception. Trainees and scientists from all NIH ICs are encouraged to attend. Made possible by the generous philanthropic support of Lona and Joram Piatigorsky, this series brings attention to notable basic sciences contributions by eye and vision scientists to a diverse general scientific audience, such as experts in molecular biology, genetics, developmental biology, neuroscience, and computer science. With special consideration for basic eye and vision scientists who take risks exploring little-studied species and imaginative ideas, the Lecture and Award promotes and communicates basic discoveries in eye and vision research that result in far-reaching observations that may inform widespread areas of science\u2014from the eye to the world as it were\u2014rather than the other way around.\nAuthor: Claude Desplan, PhD\nDownload\nCIT Live ID: 56709\nPermanent link: https://videocast.nih.gov/watch=56709\nMore...\nRelated Videos...\n07:46:18\nFrontiers of Knowledge in Sleep & Sleep Disorders: Opportunities for Improving Health and Quality of Life (Day 1)\n[Advisory Boards and Councils]\n3/29/2004\n05:15:13\nAmerican Health Information Community - January 2006\n[Advisory Boards and Councils]\n1/17/2006\n06:32:18\nNational Cancer Advisory Board - February 2008 (Day 1)\n[National Cancer Advisory Board]\n2/5/2008\n06:36:39\nScientific Management Review Board Meeting - May 2010 (Day 1)\n[Advisory Boards and Councils]\n5/18/2010\n04:38:42\nNICHD Intramural Scientific Retreat\n[Private (world)]\n9/27/2024\n01:31:02\n2024 Joram Piatigorsky Basic Science Lecture and Award\n[Special]\n9/11/2024\n01:48:11\nNational Advisory Eye Council - October 2025 (Rescheduled Date)\n[Advisory Boards and Councils]\n12/9/2025\n03:45:23\n70th Office of AIDS Research Advisory Council Meeting\n[Advisory Boards and Councils]\n1/29/2026\n06:35:42\nNIH Council of Councils\n[Council of Councils]\n1/29/2026\n02:55:25\nNational Advisory Council for Biomedical Imaging and Bioengineering\n[Advisory Boards and Councils]\n1/28/2026\nVideoCast Send Live Feedback\n\u00d7\n2025 Joram Piatigorsky Basic Science Lecture and Award\nYour name\nEmail Address\nMessage\nSend Message\nCancel\nVideoCast Downloader\n\u00d7\n2025 Joram Piatigorsky Basic Science Lecture and Award\nDownload VideoCast\nYou can download this VideoCast and play it on your device. There are multiple sizes available for you to choose from.\nSelect bitrate\n150k 440k 740k 1040k 1240k 1840k\nDownload caption text\nYou can download caption text of the VideoCast.\nDownload captions\nCaption text\nDownload Help\nClose", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/1a853491-e0d6-46f5-9a77-41bf29469600", "content_hash": "0360ec778fee70997512d8a811c386942e864bd9e9d2fc9b55ff0dd7b83a62ca", "created_at": "2026-03-28T05:10:43.049725991Z"}
{"id": "8b62b2c4-cc52-4926-a8d9-55aa0afcf6c5", "source": "brain", "text": "CDC E-Library\n\nCDC E-Library\nSkip to main content\nProcessing\nAccount Menu\nLog in\nDash\nFeatured collections\nRecent\nKnowledge Base\nSearch\nPhoto/Illustrations\nDocument\nVideo\nAudio\nCDC Notice\nShare resource - Editing external share 41085a1853\nBack to resource view\nAccess Open Restricted\nExpires Never 06 February 26 07 February 26 08 February 26 09 February 26 10 February 26 11 February 26 12 February 26 13 February 26 14 February 26 15 February 26 16 February 26 17 February 26 18 February 26 19 February 26 20 February 26 21 February 26 22 February 26 23 February 26 24 February 26 25 February 26 26 February 26 27 February 26 28 February 26 01 March 26 02 March 26 03 March 26 04 March 26 05 March 26 06 March 26 07 March 26 08 March 26 09 March 26 10 March 26 11 March 26 12 March 26 13 March 26 14 March 26 15 March 26 16 March 26 17 March 26 18 March 26 19 March 26 20 March 26 21 March 26 22 March 26 23 March 26 24 March 26 25 March 26 26 March 26 27 March 26 28 March 26 29 March 26 30 March 26 31 March 26 01 April 26 02 April 26 03 April 26 04 April 26 05 April 26 06 April 26 07 April 26 08 April 26 09 April 26 10 April 26 11 April 26 12 April 26 13 April 26 14 April 26 15 April 26 16 April 26 17 April 26 18 April 26 19 April 26 20 April 26 21 April 26 22 April 26 23 April 26 24 April 26 25 April 26 26 April 26 27 April 26 28 April 26 29 April 26 30 April 26 01 May 26 02 May 26 03 May 26 04 May 26 05 May 26 06 May 26 07 May 26 08 May 26 09 May 26 10 May 26 11 May 26 12 May 26 13 May 26 14 May 26 15 May 26 16 May 26 17 May 26 18 May 26 19 May 26 20 May 26 21 May 26 22 May 26 23 May 26 24 May 26 25 May 26 26 May 26 27 May 26 28 May 26 29 May 26 30 May 26 31 May 26 01 June 26 02 June 26 03 June 26 04 June 26 05 June 26 06 June 26 07 June 26 08 June 26 09 June 26 10 June 26 11 June 26 12 June 26 13 June 26 14 June 26 15 June 26 16 June 26 17 June 26 18 June 26 19 June 26 20 June 26 21 June 26 22 June 26 23 June 26 24 June 26 25 June 26 26 June 26 27 June 26 28 June 26 29 June 26 30 June 26 01 July 26 02 July 26 03 July 26 04 July 26 05 July 26 06 July 26\nShare password (optional)\nExternal user sharing\nAccess key Type Shared by Shared with Last updated Last used Expires Access Social media\nTools\neb69bd4eee\nShare resource guest reader (guestnew) URL 06 March 19 @ 14:21 06 February 26 @ 19:23 Never Open\nDelete Edit\nb24842e7ef\nShare resource guest reader (guestnew) URL 29 March 20 @ 18:51 06 February 26 @ 05:31 Never Open\nDelete Edit\nc0ad96db81\nShare resource guest reader (guestnew) URL 23 April 20 @ 21:51 04 February 26 @ 04:00 Never Open\nDelete Edit\n6bcd8632a4\nShare resource guest reader (guestnew) URL 28 April 20 @ 14:22 05 February 26 @ 09:23 Never Open\nDelete Edit\na052ae3692\nShare resource guest reader (guestnew) URL 12 May 20 @ 18:04 01 February 26 @ 16:55 Never Open\nDelete Edit\nf41031f32c\nShare resource guest reader (guestnew) URL 15 May 20 @ 18:38 06 February 26 @ 19:02 Never Open\nDelete Edit\n43bda13e80\nShare resource guest reader (guestnew) URL 31 May 20 @ 15:05 06 February 26 @ 04:42 Never Open\nDelete Edit\n896ba526f9\nShare resource guest reader (guestnew) URL 03 June 20 @ 17:47 05 February 26 @ 00:41 Never Open\nDelete Edit\n5429b6424c\nShare resource guest reader (guestnew) URL 17 July 20 @ 01:26 Never Open\nDelete Edit\n41085a1853\nShare resource guest reader (guestnew) URL 20 July 20 @ 21:13 06 February 26 @ 18:53 Never Open\nDelete Edit\na9f24d3950\nShare resource guest reader (guestnew) URL 27 August 20 @ 12:51 02 February 26 @ 04:03 Never Open\nDelete Edit\ne542b551a6\nShare resource guest reader (guestnew) URL 07 November 20 @ 12:11 06 February 26 @ 18:22 Never Open\nDelete Edit\n746a2f22a6\nShare resource guest reader (guestnew) <EMAIL_9> 07 November 20 @ 12:12 06 February 26 @ 19:52 Never Open\nDelete Edit\nc82c8d8b0f\nShare resource guest reader (guestnew) URL 10 November 20 @ 08:57 06 February 26 @ 16:58 Never Open\nDelete Edit\n80a914cda4\nShare resource guest reader (guestnew) URL 12 November 20 @ 03:28 24 January 26 @ 06:35 Never Open\nDelete Edit\n028930617d\nShare resource guest reader (guestnew) URL 17 December 20 @ 15:18 05 February 26 @ 01:31 Never Open\nDelete Edit\nb011a1a5a8\nShare resource guest reader (guestnew) URL 18 February 21 @ 14:21 06 February 26 @ 12:24 Never Open\nDelete Edit\nfa4d3f81ac\nShare resource guest reader (guestnew) URL 16 March 21 @ 16:01 Never Open\nDelete Edit\n134ea23432\nShare resource guest reader (guestnew) URL 01 April 21 @ 11:08 Never Open\nDelete Edit\n15c2a86228\nShare resource guest reader (guestnew) URL 16 February 23 @ 08:51 06 February 26 @ 15:53 Never Open\nDelete Edit\nCustom permissions\nNo users or groups with custom access found.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/8b62b2c4-cc52-4926-a8d9-55aa0afcf6c5", "content_hash": "fbf4ba37a2bc9c76a31bc7f52a37e6a6eeb84fe6d00a9760e1c29c372dc3cc9f", "created_at": "2026-03-28T05:10:42.934371530Z"}
{"id": "fd1258bd-12be-4feb-aeef-9ac1917f86f6", "source": "brain", "text": "Endogenous 17\u03b2-estradiol is required for activity-dependent long-term potentiation in the striatum: interaction with the dopaminergic system\n\nEndogenous 17\u03b2-estradiol is required for activity-dependent long-term potentiation in the striatum: interaction with the dopaminergic system\nEndogenous 17\u03b2-estradiol is required for activity-dependent long-term potentiation in the striatum: interaction with the dopaminergic system\nFront Cell Neurosci. 2015 May 27:9:192. doi: 10.3389/fncel.2015.00192. eCollection 2015.\nAuthors\nAlessandro Tozzi 1 , Antonio de Iure 2 , Michela Tantucci 2 , Valentina Durante 2 , Ana Quiroga-Varela 2 , Carmela Giamp\u00e0 3 , Michela Di Mauro 4 , Petra Mazzocchetti 2 , Cinzia Costa 2 , Massimiliano Di Filippo 2 , Silvarosa Grassi 4 , Vito Enrico Pettorossi 4 , Paolo Calabresi 5\nAffiliations\n1 Department of Experimental Medicine, Section of Physiology and Biochemistry, University of Perugia Perugia, Italy ; Fondazione Santa Lucia, IRCCS Rome, Italy.\n2 Clinica Neurologica, Dipartimento di Medicina, Universit\u00e0 degli Studi di Perugia, Ospedale Santa Maria della Misericordia Perugia, Italy.\n3 Fondazione Santa Lucia, IRCCS Rome, Italy.\n4 Department of Experimental Medicine, Section of Physiology and Biochemistry, University of Perugia Perugia, Italy.\n5 Fondazione Santa Lucia, IRCCS Rome, Italy ; Clinica Neurologica, Dipartimento di Medicina, Universit\u00e0 degli Studi di Perugia, Ospedale Santa Maria della Misericordia Perugia, Italy.\nPMID: 26074768\nPMCID: PMC4445326\nDOI: 10.3389/fncel.2015.00192\nAbstract\n17\u03b2-estradiol (E2), a neurosteroid synthesized by P450-aromatase (ARO), modulates various brain functions. We characterized the role of the locally synthesized E2 on striatal long-term synaptic plasticity and explored possible interactions between E2 receptors (ERs) and dopamine (DA) receptors in the dorsal striatum of adult male rats. Inhibition of E2 synthesis or antagonism of ERs prevented the induction of long-term potentiation (LTP) in both medium spiny neurons (MSNs) and cholinergic interneurons (ChIs). Activation of a D1-like DA receptor/cAMP/PKA-dependent pathway restored LTP. In MSNs exogenous E2 reversed the effect of ARO inhibition. Also antagonism of M1 muscarinic receptors prevented the D1-like receptor-mediated restoration of LTP confirming a role for ChIs in controlling the E2-mediated LTP of MSNs. A novel striatal interaction, occurring between ERs and D1-like receptors in both MSNs and ChIs, might be critical to regulate basal ganglia physiology and to compensate synaptic alterations in Parkinson's disease.\nKeywords: D1 receptor; P450-aromatase; cholinergic interneurons; estrogen receptors; long-term potentiation; medium spiny neurons; striatum; synaptic plasticity.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fd1258bd-12be-4feb-aeef-9ac1917f86f6", "content_hash": "c4d971f8f772de71487fd01625b233a3e2a3190ca3a6f67cb76a0e3cb495c895", "created_at": "2026-03-28T05:10:42.906733819Z"}
{"id": "77175976-3fef-4ad5-b670-b17bd2742406", "source": "brain", "text": "The Four Pillars of Health Coaching: Preserving the Heart of a Movement - PMC\n\nThe Four Pillars of Health Coaching: Preserving the Heart of a Movement - PMC\nSkip to main content\nAn official website of the United States government\nHere's how you know\nHere's how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.\nSearch\nLog in\nDashboard\nPublications\nAccount settings\nLog out\nSearch\u2026\nSearch NCBI\nPrimary site navigation\nSearch\nLogged in as:\nDashboard\nPublications\nAccount settings\nLog in\nSearch PMC Full-Text Archive\nSearch in PMC\nJournal List\nUser Guide\nPERMALINK\nCopy\nAs a library, NLM provides access to scientific literature. Inclusion in an NLM database does not imply endorsement of, or agreement with, the contents by NLM or the National Institutes of Health.\nLearn more: PMC Disclaimer | PMC Copyright Notice\neditorial\nGlob Adv Health Med\n. 2013 May 1;2(3):6\u20138. doi: 10.7453/gahmj.2013.038\nSearch in PMC\nSearch in PubMed\nView in NLM Catalog\nAdd to search\nShow available content in\nen\nzh\nes\nThe Four Pillars of Health Coaching: Preserving the Heart of a Movement\n\u5065\u5eb7\u8f85\u5bfc\u7684\u56db\u5927\u652f\u67f1\uff1a\u4fdd\u7559\u8fd9\u9879\u4e3e\u52a8\u7684\u6838\u5fc3\nLos cuatro pilares de la formaci\u00f3n sanitaria: conservaci\u00f3n de la esencia de un movimiento\nKaren Lawson\nKaren Lawson, MD, ABIHM\n1Center for Spirituality & Healing, University of Minnesota, Minneapolis, United States\nFind articles by Karen Lawson\n1,\u2709\nAuthor information\nArticle notes\nCopyright and License information\n1Center for Spirituality & Healing, University of Minnesota, Minneapolis, United States\n\u2709\nEmail: <EMAIL_8>\n\u2709\nCorresponding author.\nIssue date 2013 May.\n\u00a9 2013 GAHM LLC.\nThis is an open-access article distributed under the terms of the Creative Commons Attribution-Non Commercial- No Derivative 3.0 License, which permits rights to copy, distribute and transmit the work for noncommercial purposes only, provided the original work is properly cited.\nPMC Copyright notice\nPMCID: PMC3833536 PMID: 24416668\nAbstract\nIn this special themed issue of Global Advances in Health and Medicine and in articles published on the journal's website (www.gahmj.com), you will read all about this new and maturing approach to health behavior change and the social and cultural conditions in modern medicine that have called this practice into being. You will learn about its inception and history,1 the philosophic constructs of its application,2,3 and its proposed mechanism of action.4 There are multiple case reports5\u20137 and clinical studies8\u201310 expanding our scientific understanding of coaching in health and wellness and descriptions about how to educate professionals to provide this new service.11,12 A review of existing literature in the field demonstrates the rapidly growing reported demonstration of its impact.13 I believe coaching is poised to have a major transformative impact on health and healthcare internationally; it also is at risk of being usurped and thereby deformed by the power of the existing paradigm of Western disease care and reductionistic scientific thought. That is the issue I wish to raise: How do we ensure the integrity of this new approach so that it can serve as a bridge from a broken system to a new horizon of holistic health and well-being?\nKey Words: Health coaching, behavior change, Four Pillars, mind, body, spirit\nIn this special themed issue of Global Advances in Health and Medicine and in articles published on the journal's website (www.gahmj.com), you will read all about this new and maturing approach to health behavior change and the social and cultural conditions in modern medicine that have called this practice into being. You will learn about its inception and history,1 the philosophic constructs of its application,2,3 and its proposed mechanism of action.4 There are multiple case reports5\u20137 and clinical studies8\u201310 expanding our scientific understanding of coaching in health and wellness and descriptions about how to educate professionals to provide this new service.11,12 A review of existing literature in the field demonstrates the rapidly growing reported demonstration of its impact.13 I believe coaching is poised to have a major transformative impact on health and healthcare internationally; it also is at risk of being usurped and thereby deformed by the power of the existing paradigm of Western disease care and reductionistic scientific thought. That is the issue I wish to raise: How do we ensure the integrity of this new approach so that it can serve as a bridge from a broken system to a new horizon of holistic health and well-being?\nI came to my own epiphany about the limitations and casualties of contemporary medicine in the mid-1980s during my training and early practice years as a family physician. It was a time when family practice was a newly recognized specialty and was working to prove itself as a respectable and professional branch of medicine. I was privileged to have the opportunity to learn from some of the last general practitioners who still did home visits, delivered babies, performed their own surgeries, provided care to entire multigenerational families over many years, and sat at the bedsides of the dying. They were, in many ways, the last of their kind in the United States. Through the introduction and rapid dominance of health maintenance organization models, the increasing corporatization of medicine, growing subspecialty development, and burgeoning fragmentation of care, the holism I sought became a rarity in the halls of hospitals and clinics. I began a search for other approaches to health and healing that acknowledged the mind, body, and spirit of individuals and families; empowered individuals in their own decision-making; and championed the innate healing capacities of humans when they have the support and resources they need. That search led me to learn about mind-body practices, functional nutrition, movement practices, energy medicine, systems such as traditional Chinese medicine and homeopathy, and spiritual healing approaches.\nBy the late 1990s, I had become an advocate and leader of holistic medicine and shifted my professional energies to that field, hoping to transform health-care from inside of medicine. In the process of leading the development of new interdisciplinary team models for holistic clinics, it became clear to me that there was a missing provider. Whether an individual received expert guidance from doctor of medicine, a doctor of chiropractic, a naturopathic doctor, a physical therapist, or a licensed acupuncturist, the patient often left the clinic with a great deal of information about changes to make and no clear plan as to how to make them. Patients needed someone to know and understand their unique strengths, challenges, and desires\u2014someone to walk with them through the demanding process of implementing new beliefs and behaviors in their lives\u2014in a way that would promote their own health and healing at the pace for which they were ready. This person needed to be in a trusted relationship with the patient, to be readily and frequently available, to see the patient as the capable expert in his or her own life, to understand the nature of the change process, and to be able to hold the vision of greater health for and with the patient. This person was, and is, an integrative health coach.\nWhen I joined the University of Minnesota Center for Spirituality and Healing in 2002, one of the topics of exploration was this: How do we create a training program for these new providers? Who would they be? How and in which subjects did they need to be educated? For the early clinical models I had been involved with, we had identified unique and talented individuals with a passion for this work. With the support and guidance of pioneers in the field such as Linda Bark, PhD, RN, MCC, NC-BC, we trained and supervised these new providers in", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/77175976-3fef-4ad5-b670-b17bd2742406", "content_hash": "057786048b8a943205281886a99a1d5c42fe0c33c48d2ee3fd0964a1b5c3ba4c", "created_at": "2026-03-28T05:10:42.803846841Z"}
{"id": "fcf210ea-743c-40dc-a508-8b467c6d86eb", "source": "brain", "text": "Maia Fraser | OpenReview\n\nMaia Fraser | OpenReview\nToggle navigation\nOpenReview.net\nLogin\nOpen Peer Review. Open Publishing. Open Access. Open Discussion. Open Recommendations. Open Directory. Open API. Open Source. Donate\nError\nThe server responded with the following message:\nThe profile ~Maia_Fraser1 does not exist or it's not public\nAbout OpenReview\nHosting a Venue\nAll Venues\nContact\nSponsors\nDonate\nFAQ\nTerms of Use / Privacy Policy\nNews\nAbout OpenReview\nHosting a Venue\nAll Venues\nSponsors\nNews\nFAQ\nContact\nDonate\nTerms of Use\nPrivacy Policy\nOpenReview is a long-term project to advance science through improved peer review with legal nonprofit status. We gratefully acknowledge the support of the OpenReview Sponsors. \u00a9 2026 OpenReview", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fcf210ea-743c-40dc-a508-8b467c6d86eb", "content_hash": "fd3db8cc1c4fa6a66d83fcf9e6569a74469d11fdfe48a663086f8abcb94caec5", "created_at": "2026-03-28T05:10:42.721047789Z"}
{"id": "9d519d5d-1160-445a-b216-f04b46d2128b", "source": "brain", "text": "Examen de piel - PPD (brazo derecho) y Candida (izquierdo): MedlinePlus enciclopedia m\u00e9dica illustraci\u00f3n\n\nExamen de piel - PPD (brazo derecho) y Candida (izquierdo): MedlinePlus enciclopedia m\u00e9dica illustraci\u00f3n\nOmita y vaya al Contenido\nUn sitio oficial del Gobierno de Estados Unidos\nAs\u00ed es como usted puede verificarlo\nAs\u00ed es como usted puede verificarlo\nLos sitios web oficiales usan .gov\nUn sitio web .gov pertenece a una organizaci\u00f3n oficial del Gobierno de Estados Unidos.\nLos sitios web seguros .gov usan HTTPS\nUn candado ( Lock\nLocked padlock icon ) o https:// significa que usted se conect\u00f3 de forma segura a un sitio web .gov. Comparta informaci\u00f3n sensible s\u00f3lo en sitios web oficiales y seguros.\nBiblioteca Nacional de Medicina\nMen\u00fa\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nAcerca de MedlinePlus\nB\u00fasqueda\nBusque en MedlinePlus\nBUSCAR\nAcerca de MedlinePlus\nQu\u00e9 hay de nuevo\n\u00cdndice\nCont\u00e1ctenos\nTemas de salud\nMedicinas y suplementos\nGen\u00e9tica\nPruebas m\u00e9dicas\nEnciclopedia m\u00e9dica\nEnglish\nUsted est\u00e1 aqu\u00ed:\nP\u00e1gina Principal \u2192\nEnciclopedia m\u00e9dica \u2192\nExamen de piel - PPD (brazo derecho) y Candida (izquierdo)\nDirecci\u00f3n de esta p\u00e1gina: //medlineplus.gov/spanish/ency/esp_imagepages/2823.htm\nExamen de piel - PPD (brazo derecho) y Candida (izquierdo)\nPara usar las funciones de compartir de esta p\u00e1ginas, por favor, habilite JavaScript.\nRes\u00famenes\nEl brazo derecho de esta persona presenta una reacci\u00f3n positiva a la PPD (prueba de la piel para la prote\u00edna de la tuberculosis). El brazo izquierdo presenta una reacci\u00f3n positiva a la prote\u00edna de Candida. Se prueba el ant\u00edgeno de Candida para determinar si el sistema inmunitario de la persona est\u00e1 funcionando bien; un sistema inmunitario normal muestra una reacci\u00f3n positiva.\nUltima revisi\u00f3n 3/31/2024\nVersi\u00f3n en ingl\u00e9s revisada por: Deborah Pedersen, MD, MS, Allergy & Asthma Care, PC, Taunton, MA. Review provided by VeriMed Healthcare Network. Also reviewed by David C. Dugdale, MD, Medical Director, Brenda Conaway, Editorial Director, and the A.D.A.M. Editorial team.\nTraducci\u00f3n y localizaci\u00f3n realizada por: DrTango, Inc.\nConozca c\u00f3mo citar esta p\u00e1gina\nHealth Content Provider\n06/01/2028\nA.D.A.M., Inc. est\u00e1 acreditada por la URAC, tambi\u00e9n conocido como American Accreditation HealthCare Commission (www.urac.org). La acreditaci\u00f3n de la URAC es un comit\u00e9 auditor independiente para verificar que A.D.A.M. cumple los rigurosos est\u00e1ndares de calidad e integridad. A.D.A.M. es una de las primeras empresas en alcanzar esta tan importante distinci\u00f3n en servicios de salud en la red. Conozca m\u00e1s sobre la politica editorial, el proceso editorial, y la poliza de privacidad de A.D.A.M.\nLa informaci\u00f3n aqu\u00ed proporcionada no debe utilizarse durante ninguna emergencia m\u00e9dica ni para el diagn\u00f3stico o tratamiento de ninguna afecci\u00f3n m\u00e9dica. Se debe consultar a un profesional m\u00e9dico autorizado para el diagn\u00f3stico y tratamiento de cualquiera y todas las afecciones m\u00e9dicas. Los enlaces a otros sitios se proporcionan \u00fanicamente con fines informativos; no constituyen una recomendaci\u00f3n de dichos sitios. No se ofrece garant\u00eda alguna, expresa ni impl\u00edcita, en cuanto a la precisi\u00f3n, fiabilidad, puntualidad o exactitud de las traducciones realizadas por un servicio externo de la informaci\u00f3n aqu\u00ed proporcionada a cualquier otro idioma.\n\u00a9 1997- 2026 A.D.A.M., una unidad de negocio de Ebix, Inc. Queda estrictamente prohibida la duplicaci\u00f3n o distribuci\u00f3n de la informaci\u00f3n aqu\u00ed contenida.\nTodo el contenido de este sitio, incluyendo texto, im\u00e1genes, gr\u00e1ficos, audio, video, datos, metadatos y compilaciones, est\u00e1 protegido por derechos de autor y otras leyes de propiedad intelectual. Usted puede ver el contenido para uso personal y no comercial. Cualquier otro uso requiere el consentimiento previo por escrito de Ebix. Usted no puede copiar, reproducir, distribuir, transmitir, mostrar, publicar, realizar ingenier\u00eda inversa, adaptar, modificar, almacenar m\u00e1s all\u00e1 del almacenamiento en cach\u00e9 habitual del navegador, indexar, hacer miner\u00eda de datos, extraer o crear obras derivadas de este contenido. Usted no puede utilizar herramientas automatizadas para acceder o extraer contenido, incluyendo la creaci\u00f3n de incrustaciones, vectores, conjuntos de datos o \u00edndices para sistemas de recuperaci\u00f3n. Se proh\u00edbe el uso de cualquier contenido para entrenar, ajustar, calibrar, probar, evaluar o mejorar sistemas de inteligencia artificial (IA) de cualquier tipo sin el consentimiento expreso por escrito. Esto incluye modelos de lenguaje grandes, modelos de aprendizaje autom\u00e1tico, redes neuronales, sistemas generativos, sistemas de recuperaci\u00f3n aumentada y cualquier software que ingiera contenido para producir resultados. Cualquier uso no autorizado del contenido, incluyendo el uso relacionado con la IA, constituye una violaci\u00f3n de nuestros derechos y puede dar lugar a acciones legales, da\u00f1os y sanciones legales en la medida en que lo permita la ley. Ebix se reserva el derecho de hacer valer sus derechos mediante medidas legales, tecnol\u00f3gicas y contractuales.\nAcerca de MedlinePlus\nQu\u00e9 hay de nuevo\n\u00cdndice\nCont\u00e1ctenos\nRSS\nExenciones\nDerechos de autor\nPol\u00edtica de privacidad\nAccesibilidad\nPautas para enlaces\nVisores y reproductores\nHHS Divulgaci\u00f3n de Vulnerabilidad\nNational Library of Medicine 8600 Rockville Pike, Bethesda, MD 20894 U.S. Department of Health and Human Services National Institutes of Health", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/9d519d5d-1160-445a-b216-f04b46d2128b", "content_hash": "5302d161f2c2708825bc3a0cd81ef7550a45b05f19c1ae52da82ecd90e97cc7b", "created_at": "2026-03-28T05:10:42.630727603Z"}
{"id": "ede59729-123f-44a3-8c33-d8bd6ecf892f", "source": "brain", "text": "DailyMed - ELETRIPTAN HBR tablet, film coated\n\nDailyMed - ELETRIPTAN HBR tablet, film coated\nSkip to Main Content\nNational Library of Medicine\nNational Library of Medicine\nREPORT ADVERSE EVENTS |Recalls\nHome\nNews\nDailyMed Announcements\nGet RSS News & Updates\nAbout Dailymed\nCustomer Support\nSafety Reporting & Recalls\nReport Adverse Events\nFDA Saftey Recalls\nFDA Resources\nNLM SPL Resources\nDownload Data\n- All Drug Labels\n- All Indexing & REMS Files\n- All Mapping Files\nSPL Image Guidelines\nArticles & Presentations\nApplication Development Support\nResources\n- Web Services\n- Mapping Files\nHelp\nDailyMed\nAll Drugs\nHuman Drugs\nAnimal Drugs\nMore ways to search\nAdvanced Search\nBrowse Drug Classes\nLabeling Archives\nAll Drugs\nHuman Drugs\nAnimal Drugs\nHome\nNews\nDailyMed Announcements\nGet RSS News & Updates\nSearch\nAdvanced Search\nBrowse Drug Classes\nLabels Archives\nFDA Resources\nNLM SPL Resources\nDownload Data\nAll Drug Labels\nAll Index Files\nAll Mapping Files\nSPL Image Guidelines\nPresentations & Articles\nApplication Development Support\nResources\nWeb Services\nMapping Files\nHelp\nHome\nNews\nDailyMed Announcements\nGet RSS News & Updates\nFDA Resources\nNLM SPL Resources\nDownload Data\nAll Drug Labels\nAll Indexing & REMS Files\nAll Mapping Files\nSPL Image Guidelines\nPresentations & Articles\nApplication Development Support\nResources\nWeb Services\nMapping Files\nHelp\nAdvanced Search\nView More\nNews\nDailyMed Announcements\nGet RSS News & Updates\nSafety Reporting and Recalls\nReport Adverse Events\nFDA Saftey Recalls\nFDA Resources\nNLM SPL Resources\nDownload Data\n- All Drug Labels\n- All Indexing & REMS Files\n- All Mapping Files\nSPL Image Guidelines\nPresentations & Articles\nApplication Development Support\nResources\n- Web Services\n- Mapping Files\nHelp\nView More\nBrowse Drug Classes\nLabeling Archives\nAdvanced Search\nView More\nBrowse Drug Classes\nLabeling Archives\nLabel: ELETRIPTAN HBR tablet, film coated\nLabel RSS\nView Package Photos\nDrug Label Info\nSafety\nReport Adverse Events\nFDA Safety Recalls\nPresence in Breast Milk\nRelated Resources\nMedline Plus\nClinical Trials\nMore Info For This Drug\nGet Label RSS Feed\nView NDC Code(s)NEW!\nNDC Code(s): 72189-439-06\nPackager: Direct_Rx\nThis is a repackaged label.\nSource NDC Code(s): 27241-040\nCategory: HUMAN PRESCRIPTION DRUG LABEL\nDrug Label Information\nUpdated January 22, 2025\nIf you are a healthcare professional or from the pharmaceutical industry please visit this version.\nDownload DRUG LABEL INFO: PDF XML\nOfficial Label (Printer Friendly)\nView All SectionsClose All Sections\nINDICATIONS & USAGE\nEletriptan hydrobromide tablets are indicated for the acute treatment of migraine with or without aura in adults.\nLimitations of Use:\nUse only if a clear diagnosis of migraine has been established. If a patient has no response to the first migraine attack treated with eletriptan hydrobromide tablets, reconsider the diagnosis of migraine before eletriptan hydrobromide tablets are administered to treat any subsequent attacks.\nEletriptan hydrobromide tablets are not intended for the prevention of migraine attacks.\nSafety and effectiveness of eletriptan hydrobromide tablets have not been established for cluster headache.\nDOSAGE & ADMINISTRATION\nThe maximum recommended single dose is 40 mg.\nIn controlled clinical trials, single doses of 20 mg and 40 mg were effective for the acute treatment of migraine in adults. A greater proportion of patients had a response following a 40 mg dose than following a 20 mg dose [see Clinical Studies (14)].\nIf the migraine has not resolved by 2 hours after taking eletriptan hydrobromide tablets, or returns after transient improvement, a second dose may be administered at least 2 hours after the first dose. The maximum daily dose should not exceed 80 mg.\nThe safety of treating an average of more than 3 migraine attacks in a 30-day period has not been established.\nDOSAGE FORMS & STRENGTHS\n20 mg Tablets: Orange, round, biconvex, film-coated, debossed with \u201cE1\u201d on one side and plain on another side.\n40 mg Tablets: Orange, round, biconvex, film-coated, debossed with \u201cE2\u201d on one side and plain on another side.\nCONTRAINDICATIONS\nEletriptan hydrobromide tablets are contraindicated in patients with:\nIschemic coronary artery disease (CAD) (angina pectoris, history of myocardial infarction, or documented silent ischemia) or coronary artery vasospasm, including Prinzmetal\u2019s angina [see Warnings and Precautions (5.1)].\nWolff-Parkinson-White syndrome or arrhythmias associated with other cardiac accessory conduction pathway disorders [see Warnings and Precautions (5.2)].\nHistory of stroke, transient ischemic attack (TIA), or history or current evidence of hemiplegic or basilar migraine because these patients are at a higher risk of stroke [see Warnings and Precautions (5.4)].\nPeripheral vascular disease [see Warnings and Precautions (5.5)].\nIschemic bowel disease [see Warnings and Precautions (5.5)].\nUncontrolled hypertension [see Warnings and Precautions (5.8)].\nRecent use (i.e., within 24 hours) of another 5-hydroxytryptamine1 (5-HT1) agonist, ergotamine-containing medication, or ergot-type medication such as dihydroergotamine (DHE) or methysergide [see Drug Interactions (7.1)].\nHypersensitivity to eletriptan hydrobromide tablets (angioedema and anaphylaxis seen) [see Warnings and Precautions (5.9)].\nRecent use (i.e., within at least 72 hours) of the following potent CYP3A4 inhibitors: ketoconazole, itraconazole, nefazodone, troleandomycin, clarithromycin, ritonavir, or nelfinavir [see Drug Interactions (7.2) and Clinical Pharmacology (12.3)].\nWARNINGS AND PRECAUTIONS\nEletriptan hydrobromide tablets should only be used where a clear diagnosis of migraine has been established.\n5.1 Myocardial Ischemia, Myocardial Infarction, and Prinzmetal's Angina\nEletriptan hydrobromide tablets are contraindicated in patients with ischemic or vasospastic CAD. There have been rare reports of serious cardiac adverse reactions, including acute myocardial infarction, occurring within a few hours following administration of eletriptan hydrobromide tablets. Some of these reactions occurred in patients without known CAD. Eletriptan hydrobromide tablets may cause coronary artery vasospasm (Prinzmetal\u2019s angina), even in patients without a history of CAD.\nPerform a cardiovascular evaluation in triptan-naive patients who have multiple cardiovascular risk factors (e.g., increased age, diabetes, hypertension, smoking, obesity, strong family history of CAD) prior to receiving eletriptan hydrobromide tablets. Do not use eletriptan hydrobromide tablets if there is evidence of CAD or coronary artery vasospasm [see Contraindications (4)]. For patients with multiple cardiovascular risk factors who have a negative cardiovascular evaluation, consider administering the first eletriptan hydrobromide tablets dose in a medically-supervised setting and performing an electrocardiogram (ECG) immediately following administration of eletriptan hydrobromide tablets. For such patients, consider periodic cardiovascular evaluation in intermittent long-term users of eletriptan hydrobromide tablets.\n5.2 Arrhythmias\nLife-threatening disturbances of cardiac rhythm including ventricular tachycardia and ventricular fibrillation leading to death have been reported within a few hours following the administration of 5-HT1 agonists. Discontinue eletriptan hydrobromide tablets if these disturbances occur. Eletriptan hydrobromide tablets are contraindicated in patients with Wolff-Parkinson-White syndrome or arrhythmias associated with other cardiac accessory conduction pathway disorders [see Contraindications (4)].\n5.3 Chest, Throat, Neck and/or Jaw Pain/Tightness/Pressure\nSensations of tightness, pain, and pressure in the chest, throat, neck, and jaw commonly occur after treatment with eletriptan hydrobromide tablets and are usually non-cardiac in origin. However, perform a cardiac evaluation if these patients are at high cardiac risk. Eletriptan hydrobromide tablets are contraindicated in patients with CAD or Prinzmetal\u2019s variant angina [see Contr", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/ede59729-123f-44a3-8c33-d8bd6ecf892f", "content_hash": "d67edd3902f726f287486c56cc9852f469f1ad0d4901389b35ae41e01dca1e80", "created_at": "2026-03-28T05:10:42.454551100Z"}
{"id": "bf285f9c-eb85-424f-add8-008da343efc2", "source": "brain", "text": "Body temp questions..need answers please \u2014 Cancer Survivors Network\n\nBody temp questions..need answers please \u2014 Cancer Survivors Network\nThe Cancer Survivors Network (CSN) is a peer support community for cancer patients, survivors, caregivers, families, and friends! CSN is a safe place to connect with others who share your interests and experiences.\nHome\u203a Head and Neck Cancer\nBody temp questions..need answers please\nlady4darknight CSN Member Posts: 90\nJuly 2010 edited March 2014 in Head and Neck Cancer #1\nHi all...haven't been on for a bit since I went under my treatment and came home but now need some answer please. I had 20 Avian radiation treatments on my tumor and finished June 23rd. Go back on Aug.2nd to see what further treatment. Had a PEG tube placed and a Power Port. But here is my problem....I can't get my body temp to regulate. I am either freezing or sweating with no happy medium. Guys. I am in so. Missouri and it is hot and humid and I either have goosebumps and am wrapped tight or am sweating then get cold from the sweats. Has anyone else had this and how to you fix it? My other question is I seem to have no or very little saliva and this makes it difficult to eat but don't want to use my PEG if I don't have to. What is the best thing to help that and if I don't use my PEG how often do I need to flush it? Thanks for all help.\nDebbie\n0 Like Care\nComments\nKent Cass CSN Member Posts: 1,898 Member\nJuly 2010 #2\nGood to hear from you\nHad wondered how things went for you in Tulsa.\nThyroid has a big influence on body temp. I'm only aware of feeling cold due to thyroid function, but hot may also be part of it.\nNot uncommom to wash things down, due to lack of saliva, Debbie. Saliva glands do take a major hit w/treatment. Typical to adjust our food intake to fit the circumstances- trial and error. Ensure and Boost are good liquids- you need plenty of good calories in you/day. Fruit and vegetable produce is good, too.\nAs for the PEG flushes- did you get any big syringes? If so, wouldn't hurt to squirt 1/2-tube of water down the PEG every couple days. Am curious about your getting the Port- have they used it, yet? Typical for the Ports to be installed for treatment with pump(s), and the feeding tube for times when regular eating becomes too difficult. No surgery, other than the PEG and Port placements?\nWas concerned about you, Debbie, as I know several others were, equally. Even if by PM, I would like an update on your status- important things the Drs. have told you about your battle with C, the specifics on your treatment, and how you're holding-up. Hope to get a response from you, Debbie.\nBelieve\nkcass\n0 Like Care\nSkiffin16 CSN Member Posts: 8,305 Member\nJuly 2010 #3\nTemperature\nAre you having Amifostine injections (eythol)... I had bad temperature swings when I was having those. When I stopped, no more problems....\nThyroid function is another variable as for fatigue, and body temperature. Have they tested you during blood labs (TSH testing)....\nJG\n0 Like Care\nScambuster CSN Member Posts: 970\nJuly 2010 #4\nHot n' Cold\nHi Debbie,\nNice to hear you are finished treatments. I suffered the Hot n Cold thing for the last 2+ weeks of treatment and a week or two after. I then only really felt the cold and this went on for some time- about 2-3 months. As you are in summer over there, that shouldn't be too bad for you. I think many of us go through a similar trend.\nI found the cold to be a problem (this was in mid spring so temps were a little cool) and since the doctors couldn't help I knew a lady who did 'energy healing' (or touch healing/natural healling), and I went to see her. Many may think it's rubbish but after 2 sessions with her, the condition improved 90%. I now don't feel the heat as much as most and now only very slightly more sensitive to the cold. Not really sure how it all works, don't care but it worked for me.\nThe consensus is this is related to the thyroid and that the Radiation causes some damage to the thyroid making it hard for you to regulate your body temperature.\nOn the dry mouth, this is a tough one and depending on how much and where the rads hit your mouth, you may or may not get back some or most of your saliva function. We have three mains pairs of salivary glands which produce the majority, but luckily there are a load of tiny ones spread throughout your mouth. If the major S 'Glands took a direct hit, the damage and effect may be permanent. I had the same dilemma and as the doctors just shook their heads - I went elsewhere. I have had about 8 sessions of acupuncture and have regained 10-15% of my saliva. While not a perfect result, it certainly does make things easier. I also take echinacea every day which is supposed to help too. I still need liquid (Water or soup) when I eat, and I 'lube up' my salads with olive oil, but if I keep my mouth closed, I can manage to keep my teeth wet.\nHaving enough saliva to moisten your mouth is critic for your teeth. I would recommend you try GC Mousse or a similar product. It is applied to the teeth in the evening before bed to protect them. You also need to brush after every meal and floss at least in the evening. Rigorous dental care is a must now. I use the Biotene mouthwash and toothpaste or a medicated or natural toothpaste (Avoid the Colgates etc).\nThings should settle soon Debbie. You body had taken a beating so give it time to heal and the food it needs to do that.\nRegds\nScambuster\n0 Like Care\nlady4darknight CSN Member Posts: 90\nJuly 2010 #5\nKent Cass said:\nGood to hear from you\nHad wondered how things went for you in Tulsa.\nThyroid has a big influence on body temp. I'm only aware of feeling cold due to thyroid function, but hot may also be part of it.\nNot uncommom to wash things down, due to lack of saliva, Debbie. Saliva glands do take a major hit w/treatment. Typical to adjust our food intake to fit the circumstances- trial and error. Ensure and Boost are good liquids- you need plenty of good calories in you/day. Fruit and vegetable produce is good, too.\nAs for the PEG flushes- did you get any big syringes? If so, wouldn't hurt to squirt 1/2-tube of water down the PEG every couple days. Am curious about your getting the Port- have they used it, yet? Typical for the Ports to be installed for treatment with pump(s), and the feeding tube for times when regular eating becomes too difficult. No surgery, other than the PEG and Port placements?\nWas concerned about you, Debbie, as I know several others were, equally. Even if by PM, I would like an update on your status- important things the Drs. have told you about your battle with C, the specifics on your treatment, and how you're holding-up. Hope to get a response from you, Debbie.\nBelieve\nkcass\nHello\nHi, Sorry I didn't update everyone but my treatments and everything happened so fast and then the surgeries to place the PEG and Port which I didn't expect just threw me for a loop. I have had a total of 5 surgeries to reduce the size of the tumor and had 20 rad treatments. I had to have that horrible mask made for my face and used for radiation treatments and I am claustrophobic really bad so I had a difficult time with my treatments. Since my treatments have stopped and I have been home, I have had a time of remembering things that happened. I looked at pictures I took of when my family visited me and I have no memory of any of that time. Is that normal? Seems like I have 3 weeks I can't remember. Total blackout.\nThanks for the info on my PEG. I will make sure to flush it daily. I ave some 60 cc syringes that I got so I will flush with 30 cc twice a day.\nAs for my Port, it was used for all my blood tests but other than that not at all. I have found no one here at home will not access it so I will have to make sure to get it flushed at the local hospital monthly.\nI have had damage to my larynx and my epigilitos because of the size of my tumor. Both of them are laying flat. The drs. say my larynx will still interfere with my breathing so I may not get my trache removed. But I have noticed since my last sur", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/bf285f9c-eb85-424f-add8-008da343efc2", "content_hash": "badc6116d84974b543dfd8517242681eda6266fdd93fdbb299044a0b860562a1", "created_at": "2026-03-28T05:10:42.354577265Z"}
{"id": "71ab2b53-5ce3-47ca-832e-ab6c86e2ede0", "source": "brain", "text": "Chronic obstructive pulmonary disease (COPD) - Evidence | BMJ Best Practice US\n\nChronic obstructive pulmonary disease (COPD) - Evidence | BMJ Best Practice US\nSkip to main contentSkip to search\nEnglish (US)EnglishPortugu\u00eas\nLog in\nPersonal account\nAccess through your institution(Open Athens)\nSubscribe\nAccess through your institution\nLog in\nEnglish (US)EnglishPortugu\u00eas\nHome\nSearch\n\ue8b6Search\nHome\nAbout us\nOverviewWhat is BMJ Best Practice?Our history\nKey featuresClinical tools Local guidanceEarn CME/CPD pointsAccess anywhereOur appIntegration\nOur Evidence approachTrusted contentUpdating process\nWho we help\nBest Practice for...CliniciansHospitalsMedical librariansMedical schoolsMedical studentsNursesPharmacistsPrimary careParamedicsTelehealth\nHow we help\nImpact and effectivenessEvidence of effectiveness Global impactCustomer stories\nBrowse clinical content\nRecent updates\nSpecialties\nTry a free topic\nPatient information\nVideos\nCalculators\nWhat\u2019s new\nClinical updates\nNews\nPodcast\nAccess\nLog in via...Personal subscription or user profileAccess through your institution\nAccess code\nSubscribe\nFree trial\nHow do I get access?\nDownload the app\nHelp\nFAQs\nHow do I get access?\nContact us\nChronic obstructive pulmonary disease (COPD)\nView PDF\n\ue5d4 Menu\ue5d4 Close\nOverview \ue313\ue316\nTheory \ue313\ue316\nDiagnosis \ue313\ue316\nManagement \ue313\ue316\nFollow up \ue313\ue316\nResources \ue313\ue316\nOverview\ue313\ue316\nSummary\nTheory\ue313\ue316\nEpidemiology\nEtiology\nCase history\nDiagnosis\ue313\ue316\nApproach\nHistory and exam\nTests\nDifferentials\nCriteria\nScreening\nManagement\ue313\ue316\nApproach\nTreatment algorithm\nEmerging\nPrevention\nPatient discussions\nFollow up\ue313\ue316\nMonitoring\nComplications\nPrognosis\nResources\ue313\ue316\nGuidelines\nImages and videos\nReferences\nPatient information\nCalculators\nEvidence\nThis topic is available for free\nEvidence\nThis page contains a snapshot of featured content which highlights evidence addressing key clinical questions including areas of uncertainty. Please see the main topic reference list for details of all sources underpinning this topic.\nBMJ Best Practice evidence tables\nEvidence tables provide easily navigated layers of evidence in the context of specific clinical questions, using GRADE and a BMJ Best Practice Effectiveness rating. Follow the links at the bottom of the table, which go to the related evidence score in the main topic text, providing additional context for the clinical question. Find out more about our evidence tables.\nVIEW ALL\ue313\n\ue5cf\nWhat are the effects of integrated disease management (IDM) interventions for people with chronic obstructive pulmonary disease (COPD)?\nThis table is a summary of the analysis reported in a Cochrane Clinical Answer that focuses on the above important clinical question.\nView the full source Cochrane Clinical Answer\nEvidence A?\nConfidence in the evidence is high or moderate to high where GRADE has been performed and the intervention is more effective/beneficial than the comparison for key outcomes.\nPopulation: Adults with COPD\nIntervention: IDM \u1d43\nComparison: Usual care (regular follow-up visits with healthcare providers)\nOutcome\nEffectiveness (BMJ rating)?\nConfidence in evidence (GRADE)?\nQuality of life (>6 to 15 months): St. George\u2019s Respiratory Questionnaire (SGRQ) \u1d47\nFavors intervention\nModerate\nFunctional exercise capacity (>6 to 15 months)\nFavors intervention\nModerate\nRespiratory\u2010related hospital admissions (12 months)\nFavors intervention\nHigh\nAll hospital admissions\nFavors intervention\nModerate\nHospital days per patient (all causes)\nFavors intervention\nModerate\nEmergency Department visits\nFavors intervention\nModerate\nNumber of patients experiencing \u2265 1 exacerbation\nNo statistically significant difference\nGRADE assessment not performed for this outcome\nMortality\nNo statistically significant difference\nGRADE assessment not performed for this outcome\nNeed for at least one course of oral steroids\nNo statistically significant difference\nGRADE assessment not performed for this outcome\nNeed for at least one course of antibiotics\nNo statistically significant difference\nGRADE assessment not performed for this outcome\nNote\nThe Cochrane review which underpins this Cochrane Clinical Answer (CCA) notes that the effects of IDM are better in the short and medium term, and that the effect size was different between included studies and interventions. IDM should be carefully designed and evaluated, consisting of different components which are linked to the personal goals of the patient.\n\u1d43 Including organizational, professional, patient-directed, and financial interventions in primary, secondary, and tertiary healthcare settings. See CCA and the underlying Cochrane review for more information on specific interventions and the dominant components of the IDM programs.\n\u1d47 Although statistically significant, this result did not quite reach the minimum clinically important difference. The CCA also reports a subgroup analysis for quality of life measured by the Chronic Respiratory Questionnaire. However, this was only reported in two studies and the analysis was underpowered.\nThis evidence table is related to the following section/s:\nManagement Approach\n\ue5cf\nHow does umeclidinium compare with placebo for people with chronic obstructive pulmonary disease (COPD)?\nThis table is a summary of the analysis reported in a Cochrane Clinical Answer that focuses on the above important clinical question.\nView the full source Cochrane Clinical Answer\nEvidence A?\nConfidence in the evidence is high or moderate to high where GRADE has been performed and the intervention is more effective/beneficial than the comparison for key outcomes.\nPopulation: Adults with moderate-to-severe COPD\nIntervention: Umeclidinium (once daily via a dry powder inhaler for 12-52 weeks)\nComparison: Placebo\nOutcome\nEffectiveness (BMJ rating)?\nConfidence in evidence (GRADE)?\nNumber of participants with exacerbations requiring corticosteroids, antibiotics, or both at 52 weeks\nFavors intervention\nHigh\nQuality of life at 24-52 weeks (measured by the St George's Respiratory Questionnaire [SGRQ])\nFavors intervention\nModerate\nNumber of participants with hospital admissions due to COPD exacerbation at 52 weeks (measured by the Transitional Dyspnea Index [TDI])\nNo statistically significant difference\nLow\nImprovement in symptoms at 24 weeks\nFavors intervention\nHigh\nLung function at 4-52 weeks\nFavors intervention\nHigh\nNonfatal serious adverse events\nNo statistically significant difference\nModerate\nAdverse events\nNo statistically significant difference\nModerate\nThis evidence table is related to the following section/s:\nTreatment algorithm\nManagement Approach\nCochrane Clinical Answers\nCochrane Clinical Answers (CCAs) provide a readable, digestible, clinically focused entry point to rigorous research from Cochrane systematic reviews. They are designed to be actionable and to inform decision making at the point of care and have been added to relevant sections of the main Best Practice text.\nWhat are the effects of integrated disease management (IDM) interventions for people with chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nHow does tiotropium compare with ipratropium bromide for people with chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nHow does umeclidinium bromide compare with placebo for people with chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nHow does a combined inhaler with once\u2010daily long\u2010acting beta2\u2010agonist (LABA) plus a long\u2010acting muscarinic antagonist (LAMA) compare with placebo for adults with chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nHow does long\u2010acting muscarinic antagonist (LAMA) plus long\u2010acting beta\u2010agonist (LABA) compare with LABA plus inhaled corticosteroid (ICS) for people with stable chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nWhat are the benefits and harms of inhaled corticosteroids (ICS) in people with stable chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nWhat are the effects of long\u2010acting inhaled therapies for adults with chronic obstructive pulmonary disease (COPD)?\nShow me the answer\nHow do phosphodiesterase\u20104 inhibitors", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/71ab2b53-5ce3-47ca-832e-ab6c86e2ede0", "content_hash": "166d5dc3dcf4387305b1b06514360651648ed8b43486aed3fd559aad78491c70", "created_at": "2026-03-28T05:10:42.248584247Z"}
{"id": "5717365f-5cd5-4d34-baa0-61489ac0fe9b", "source": "brain", "text": "Valerie Novak - ACL Anthology\n\nValerie Novak - ACL Anthology\nACL Anthology\nNews(current)\nFAQ(current)\nCorrections(current)\nSubmissions(current)\nGitHub\nValerie Novak\n2022\npdf bib abs\nRU-ADEPT: Russian Anonymized Dataset with Eight Personality Traits\nC. Anton Rytting | Valerie Novak | James R. Hull | Victor M. Frank | Paul Rodrigues | Jarrett G. W. Lee | Laurel Miller-Sims\nProceedings of the Thirteenth Language Resources and Evaluation Conference\nSocial media has provided a platform for many individuals to easily express themselves naturally and publicly, and researchers have had the opportunity to utilize large quantities of this data to improve author trait analysis techniques and to improve author trait profiling systems. The majority of the work in this area, however, has been narrowly spent on English and other Western European languages, and generally focuses on a single social network at a time, despite the large quantity of data now available across languages and differences that have been found across platforms. This paper introduces RU-ADEPT, a dataset of Russian authors\u2019 personality trait scores\u2013Big Five and Dark Triad, demographic information (e.g. age, gender), with associated corpus of the authors\u2019 cross-contributions to (up to) four different social media platforms\u2013VKontakte (VK), LiveJournal, Blogger, and Moi Mir. We believe this to be the first publicly-available dataset associating demographic and personality trait data with Russian-language social media content, the first paper to describe the collection of Dark Triad scores with texts across multiple Russian-language social media platforms, and to a limited extent, the first publicly-available dataset of personality traits to author content across several different social media sites.\n2021\npdf bib abs\nPersonality Trait Identification Using the Russian Feature Extraction Toolkit\nJames R. Hull | Valerie Novak | C. Anton Rytting | Paul Rodrigues | Victor M. Frank | Matthew Swahn\nProceedings of the International Conference on Recent Advances in Natural Language Processing (RANLP 2021)\nFeature engineering is an important step in classical NLP pipelines, but machine learning engineers may not be aware of the signals to look for when processing foreign language text. The Russian Feature Extraction Toolkit (RFET) is a collection of feature extraction libraries bundled for ease of use by engineers who do not speak Russian. RFET\u2019s current feature set includes features applicable to social media genres of text and to computational social science tasks. We demonstrate the effectiveness of the tool by using it in a personality trait identification task. We compare the performance of Support Vector Machines (SVMs) trained with and without the features provided by RFET; we also compare it to a SVM with neural embedding features generated by Sentence-BERT.\n2018\npdf bib\nArabic Data Science Toolkit: An API for Arabic Language Feature Extraction\nPaul Rodrigues | Valerie Novak | C. Anton Rytting | Julie Yelle | Jennifer Boutz\nProceedings of the Eleventh International Conference on Language Resources and Evaluation (LREC 2018)\n2014\npdf bib\nArCADE: An Arabic Corpus of Auditory Dictation Errors\nC. Anton Rytting | Paul Rodrigues | Tim Buckwalter | Valerie Novak | Aric Bills | Noah H. Silbert | Mohini Madgavkar\nProceedings of the Ninth Workshop on Innovative Use of NLP for Building Educational Applications\nSearch\nCo-authors\nPaul Rodrigues 4\nC. Anton Rytting 4\nVictor M. Frank 2\nJames R. Hull 2\nAric Bills 1\nshow all...\nJennifer Boutz 1\nTim Buckwalter 1\nJarrett G. W. Lee 1\nMohini Madgavkar 1\nLaurel Miller-Sims 1\nNoah H. Silbert 1\nMatthew Swahn 1\nJulie Yelle 1\nVenues\nlrec2\nbea1\nranlp1\nFix author\nACL materials are Copyright \u00a9 1963\u20132026 ACL; other materials are copyrighted by their respective copyright holders. Materials prior to 2016 here are licensed under the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 International License. Permission is granted to make copies for the purposes of teaching and research. Materials published in or after 2016 are licensed on a Creative Commons Attribution 4.0 International License.\nThe ACL Anthology is managed and built by the ACL Anthology team of volunteers.\nSite last built on 06 February 2026 at 10:32 UTC with commit 3edd046.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/5717365f-5cd5-4d34-baa0-61489ac0fe9b", "content_hash": "407e6ccaabd616fdab3fae9b56b4ae797e4b4a9ae95ceafe40e39849c8309c15", "created_at": "2026-03-28T05:10:41.963536083Z"}
{"id": "ed33461c-c632-4491-93c9-75ce7612cde9", "source": "brain", "text": "My Account - \u0420\u0435\u0454\u0441\u0442\u0440\u0430\u0446\u0456\u044f\n\nMy Account - \u0420\u0435\u0454\u0441\u0442\u0440\u0430\u0446\u0456\u044f\nJump to: Page Content, Site Navigation, Site Search\n\u0443\u043a\u0440\u0430\u0457\u0301\u043d\u0441\u044c\u043a\u0430 \u043c\u043e\u0301\u0432\u0430\nEnglish\nPortugu\u00eas (Brasil)\nEspa\u00f1ol\n\u4e2d\u6587(\u7b80\u4f53)\n\u10e5\u10d0\u10e0\u10d7\u10e3\u10da\u10d8\nAz\u0259rbaycanca\n\u0443\u043a\u0440\u0430\u0457\u0301\u043d\u0441\u044c\u043a\u0430 \u043c\u043e\u0301\u0432\u0430\nTi\u1ebfng Vi\u1ec7t\n\u0420\u0443\u0441\u0441\u043a\u0438\u0439\nMy Account\n\u041f\u043e\u0447\u0430\u0442\u043e\u043a \u0440\u043e\u0431\u043e\u0442\u0438\n\u041f\u0440\u043e \u0412\u0430\u0441\n\u0417\u0430\u0432\u0435\u0440\u0448\u0438\u0442\u0438\n\u0411\u0443\u0434\u044c \u043b\u0430\u0441\u043a\u0430, \u0432\u0432\u0435\u0434\u0456\u0442\u044c \u0441\u0432\u043e\u044e \u0430\u0434\u0440\u0435\u0441\u0443 \u0435\u043b\u0435\u043a\u0442\u0440\u043e\u043d\u043d\u043e\u0457 \u043f\u043e\u0448\u0442\u0438, \u0449\u043e\u0431 \u043c\u0438 \u043c\u043e\u0433\u043b\u0438 \u0432\u0438\u0437\u043d\u0430\u0447\u0438\u0442\u0438, \u0447\u0438 \u0454 \u0432\u0436\u0435 \u0443 \u0412\u0430\u0441 \u043e\u0431\u043b\u0456\u043a\u043e\u0432\u0438\u0439 \u0437\u0430\u043f\u0438\u0441.\nEmail\n\u041f\u0440\u043e\u0434\u043e\u0432\u0436\u0438\u0442\u0438\nCookie settings\n\u041a\u043e\u043d\u0442\u0430\u043a\u0442\u0438\n\u041f\u0440\u0430\u0432\u0438\u043b\u0430 \u0442\u0430 \u0443\u043c\u043e\u0432\u0438 \u0441\u0430\u0439\u0442\u0443\n\u041f\u043e\u043b\u0456\u0442\u0438\u043a\u0430 \u043a\u043e\u043d\u0444\u0456\u0434\u0435\u043d\u0446\u0456\u0439\u043d\u043e\u0441\u0442\u0456 \u0442\u0430 \u0432\u0438\u043a\u043e\u0440\u0438\u0441\u0442\u0430\u043d\u043d\u044f \u043a\u0443\u043a\u0456\n\u00a9 BMJ Publishing Group Limited 2026. \u0423\u0441\u0456 \u043f\u0440\u0430\u0432\u0430 \u0437\u0430\u0445\u0438\u0449\u0435\u043d\u043e.", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/ed33461c-c632-4491-93c9-75ce7612cde9", "content_hash": "ecb415f02cc17e83762e82d628f7ccb9cbbc4c37f9514dd4d53669b2daee8d1b", "created_at": "2026-03-28T05:10:40.921379206Z"}
{"id": "abb3e0a0-3a7d-46bb-89ec-ea20794da21d", "source": "brain", "text": "H\u00e1fnio e Ni\u00f3bio Tabela Peri\u00f3dica\n\nH\u00e1fnio e Ni\u00f3bio Tabela Peri\u00f3dica\n\u00d7\nH\u00e1fnio\n\u2612\nNi\u00f3bio\n\u2612\nTop\nADD \u2295\nCompare\nComparar Metais\nmetais de transi\u00e7\u00e3o\nS\u00e9rie actinide\ns\u00e9rie lantan\u00eddeos\nPostar Transi\u00e7\u00e3o Metal\nmetais alcalinos terrestres\nMetais alcalinos\n\u2315\n\u25bc\nX\nH\u00e1fnio\nX\nNi\u00f3bio\nH\u00e1fnio e Ni\u00f3bio Tabela Peri\u00f3dica\nH\u00e1fnio\nNi\u00f3bio\nAdd \u2295\nResumo\nTabela Peri\u00f3dica\nFatos\nusos\nF\u00edsico\nQu\u00edmico\nat\u00f4mico\nMec\u00e2nico\nMagn\u00e9tico\nT\u00e9rmico\nTodos\nTabela Peri\u00f3dica\nS\u00edmbolo\nHf\nNb\nN\u00famero grupo\n45\n0 17\n\ud83d\udc46\ud83c\udffb\nN\u00famero per\u00edodo\n65\n2 7\n\ud83d\udc46\ud83c\udffb\nQuadra\nd\nd\nFam\u00edlia Elemento\nTransi\u00e7\u00e3o\nTransi\u00e7\u00e3o\nN\u00famero CAS\n74405867440031\n7429905 54386242\n\ud83d\udc46\ud83c\udffb\nEspa\u00e7o grupo nome\nP63/mmc\nIm_ 3m\nEspa\u00e7o Grupo N\u00famero\n194,00229,00\n11 276\n\ud83d\udc46\ud83c\udffb\nComparar metais de transi\u00e7\u00e3o \u00bb Mais\nH\u00e1fnio vs B\u00f3hrio\nH\u00e1fnio vs D\u00fabnio\nH\u00e1fnio vs Copern\u00edcio\n\u00bb Mais Comparar metais de transi\u00e7\u00e3o\nmetais de transi\u00e7\u00e3o \u00bb Mais\nR\u00eanio Metal\nSeaborgium Metal\nH\u00e1ssio Metal\nRutherf\u00f3rdio Metal\nB\u00f3hrio Metal\nD\u00fabnio Metal\n\u00bb Mais metais de transi\u00e7\u00e3o\nmetais de transi\u00e7\u00e3o \u00bb Mais\nCopern\u00edcio Metal\nTabela Pe... | Fatos | usos | F\u00edsico\nNi\u00f3bio Metal\nTabela Pe... | Fatos | usos | F\u00edsico\nRut\u00eanio Metal\nTabela Pe... | Fatos | usos | F\u00edsico\nComparar metais de transi\u00e7\u00e3o \u00bb Mais\nNi\u00f3bio vs Seaborgium\nTabela Pe... | Fatos | usos | F\u00edsico\nNi\u00f3bio vs H\u00e1ssio\nTabela Pe... | Fatos | usos | F\u00edsico\nNi\u00f3bio vs Rutherf\u00f3rdio\nTabela Pe... | Fatos | usos | F\u00edsico\nEnglish\nEspa\u00f1ol\n\u65e5\u672c\u8a9e\nfran\u00e7ais\nDeutsche\nitaliano\n\ud55c\uad6d\uc5b4\nPolskie\n\u0939\u093f\u0902\u0926\u0940\n\u092e\u0930\u093e\u0920\u0940\n\u4e2d\u6587\nDutch\nT\u00fcrk\nRom\u00e2n\u0103\nTi\u1ebfng Vi\u1ec7t\nbahasa Indonesia\nJawa\nHome |\nAbout |\nContact |\nDisclaimer |\nTerms of Use |\nPrivacy Policy\n\u00a9 2015 - 2026 www.compareusvista.com\nDeveloped & Maintained by softUsvista Inc.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/abb3e0a0-3a7d-46bb-89ec-ea20794da21d", "content_hash": "26f08dc9470a4a4916bc7f98ce5c5f3b86805a218d692c6486c52e4a9a3e1418", "created_at": "2026-03-28T05:10:40.805672339Z"}
{"id": "f0134acd-a98c-4cb9-bd9e-b7bd12b29390", "source": "brain", "text": "Report of the cholera at Sacramento in 1852: its analogy if not identity with malignant congestive intermittent : the attendant meteorological phen...\n\nReport of the cholera at Sacramento in 1852: its analogy if not identity with malignant congestive intermittent : the attendant meteorological phenomena : history, pathology and treatment of the disease : a letter to the editor - Digital Collections - National Library of Medicine\nSkip to search Skip to main content\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\nReport of the cholera at Sacramento in 1852: its analogy if not identity with malignant congestive intermittent : the attendant meteorological phenomena : history, pathology and treatment of the disease : a letter to the editor\nReport of the cholera at Sacramento in 1852: its analogy if not identity with malignant congestive intermittent : the attendant meteorological phenomena : history, pathology and treatment of the disease : a letter to the editor\nCollection:\nCholera Online, 1817 to 1923\nMedicine in the Americas, 1610-1920\nAuthor(s):\nLogan, Thos. M. (Thomas Muldrup), 1808-1876\nPublication:\n[New Orleans? : s.n., 1853?]\nLanguage(s):\nEnglish\nFormat:\nText\nSubject(s):\nCholera\nDisease Outbreaks\nMeteorological Concepts\nCalifornia\nCopyright:\nThe National Library of Medicine believes this item to be in the public domain (More information)\nExtent:\np. 488-500\nNLM Unique ID:\n34711310R (See catalog record)\nPermanent Link:\nhttp://resource.nlm.nih.gov/34711310R\nView Book\nDownload\nBook (PDF) OCR (Text) Metadata (Dublin Core)\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/f0134acd-a98c-4cb9-bd9e-b7bd12b29390", "content_hash": "6cd25aff19785136b6d134b88f1d289faac31a9809dba140e75b471b12ea0823", "created_at": "2026-03-28T05:10:40.725341765Z"}
{"id": "58610086-ed67-4d57-84d6-4052ac848871", "source": "brain", "text": "Digital Collections - National Library of Medicine\n\nDigital Collections - National Library of Medicine\nSkip to search Skip to main content\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\n\u00ab Previous Next \u00bb\nA-Z Sort Numerical Sort\nTitles\n\u00d7\nAll\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\n\u00ab Previous Next \u00bb\nA-Z Sort Numerical Sort\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/58610086-ed67-4d57-84d6-4052ac848871", "content_hash": "ac2585db6b3b91ff3dc7675c3d438f1e81093bc4c9fd48f44671378f23fa2b50", "created_at": "2026-03-28T05:10:40.719609482Z"}
{"id": "edc966e4-ed80-4217-861d-8e9703d0ab66", "source": "brain", "text": "Sahajpreet Singh - ACL Anthology\n\nSahajpreet Singh - ACL Anthology\nACL Anthology\nNews(current)\nFAQ(current)\nCorrections(current)\nSubmissions(current)\nGitHub\nSahajpreet Singh\n2024\npdf bib abs\nHate Personified: Investigating the role of LLMs in content moderation\nSarah Masud | Sahajpreet Singh | Viktor Hangya | Alexander Fraser | Tanmoy Chakraborty\nProceedings of the 2024 Conference on Empirical Methods in Natural Language Processing\nFor subjective tasks such as hate detection, where people perceive hate differently, the Large Language Model\u2019s (LLM) ability to represent diverse groups is unclear. By including additional context in prompts, we comprehensively analyze LLM\u2019s sensitivity to geographical priming, persona attributes, and numerical information to assess how well the needs of various groups are reflected. Our findings on two LLMs, five languages, and six datasets reveal that mimicking persona-based attributes leads to annotation variability. Meanwhile, incorporating geographical signals leads to better regional alignment. We also find that the LLMs are sensitive to numerical anchors, indicating the ability to leverage community-based flagging efforts and exposure to adversaries. Our work provides preliminary guidelines and highlights the nuances of applying LLMs in culturally sensitive cases.\npdf bib abs\nIntent-conditioned and Non-toxic Counterspeech Generation using Multi-Task Instruction Tuning with RLAIF\nAmey Hengle | Aswini Padhi | Sahajpreet Singh | Anil Bandhakavi | Md Shad Akhtar | Tanmoy Chakraborty\nProceedings of the 2024 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies (Volume 1: Long Papers)\nCounterspeech, defined as a response to mitigate online hate speech, is increasingly used as a non-censorial solution. The effectiveness of addressing hate speech involves dispelling the stereotypes, prejudices, and biases often subtly implied in brief, single-sentence statements or abuses. These expressions challenge language models, especially in seq2seq tasks, as model performance typically excels with longer contexts. Our study introduces CoARL, a novel framework enhancing counterspeech generation by modeling the pragmatic implications underlying social biases in hateful statements. The first two phases of CoARL involve sequential multi-instruction tuning, teaching the model to understand intents, reactions, and harms of offensive statements, and then learning task-specific low-rank adapter weights for generating intent-conditioned counterspeech. The final phase uses reinforcement learning to fine-tune outputs for effectiveness and nontoxicity. CoARL outperforms existing benchmarks in intent-conditioned counterspeech generation, showing an average improvement of \u223c3 points in intent-conformity and \u223c4 points in argument-quality metrics. Extensive human evaluation supports CoARL\u2019s efficacy in generating superior and more context-appropriate responses compared to existing systems, including prominent LLMs like ChatGPT.\nSearch\nCo-authors\nTanmoy Chakraborty 2\nMd. Shad Akhtar 1\nAnil Bandhakavi 1\nAlexander Fraser 1\nViktor Hangya 1\nshow all...\nAmey Hengle 1\nSarah Masud 1\nAswini Padhi 1\nVenues\nemnlp1\nnaacl1\nFix author\nACL materials are Copyright \u00a9 1963\u20132026 ACL; other materials are copyrighted by their respective copyright holders. Materials prior to 2016 here are licensed under the Creative Commons Attribution-NonCommercial-ShareAlike 3.0 International License. Permission is granted to make copies for the purposes of teaching and research. Materials published in or after 2016 are licensed on a Creative Commons Attribution 4.0 International License.\nThe ACL Anthology is managed and built by the ACL Anthology team of volunteers.\nSite last built on 06 February 2026 at 10:32 UTC with commit 3edd046.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/edc966e4-ed80-4217-861d-8e9703d0ab66", "content_hash": "fbfa2bf1211575cce7cd4906acecbe1b41d591c7b55e3746b9417ba0878b6f5d", "created_at": "2026-03-28T05:10:40.719598249Z"}
{"id": "5fdd0def-16c4-4f99-b821-5f7fb0b3d6be", "source": "brain", "text": "Primary Care in Rochester and Kasson\n\nPrimary Care in Rochester and Kasson\nSearch\nTwitter\nFacebook\nPinterest\nYouTube\nHome\nFind a Clinic\nFind a Job\nLog in to Patient Account\nHome\nFeatured Stories\nColor Your Way\nPrimary Care in Rochester and Kasson\nCare Team\nLocations / Hours\nCare Options\nPrimary Care\nPrimary Care On Demand\nNeed Care Now?\nPrevention & Wellness\nHealth Forms\nFeatures\nClasses / Events\nFeatured Stories\nFeatured Videos\nFAQs\nContact Us\nFind a Study\nColor your way to 5 a day\n7/23/2018 by Rose Prissel, MS, RDN, LD\nWith fresh, in-season fruits and vegetables flooding into supermarkets and local farmers markets, it's a perfect time to practice and have fun \"painting\" your plate with color.\nThere are thousands of health-promoting phytochemicals found in plants. Researchers are just beginning to understand how they work to improve our health. But they do know it's important to eat a wide variety of colorful fruits and veggies to reap those health benefits.\nPutting a rainbow of colors on your plate or in your lunch bag can make it easier to eat the five to nine services of fruits and vegetables recommended for every day. Painting your plate starts at the supermarket or farmers market. When shopping, look for an array of colors, choosing ones you and your family love and maybe experimenting with something new.\nHere are some ideas for fruits and veggies to help you build your healthy-eating paint box:\nRed: Strawberries, raspberries, cherries, watermelon, apples, radishes, tomatoes, red kidney beans, red peppers (spicy or sweet), red-skinned potatoes\nOrange: Oranges, apricots, peaches, cantaloupe, mangoes, sweet potatoes, acorn squash, pumpkin, summer squash, carrots\nYellow: Lemons, pineapple, golden apples, bananas, starfruit, yellow tomatoes, sweet corn, yellow peppers, summer squash, golden beets\nGreen: Kiwi fruit, green grapes, avocados, Granny Smith apples, honeydew melon, spinach, green beans, broccoli, Brussels sprouts, snap peas\nBlue/purple. Blueberries, blackberries, boysenberries, black seedless grapes, plums, raisins, purple cabbage, eggplant, purple potatoes, radicchio\nWhite. Grapefruit, pears, baking potatoes, onions, mushrooms, jicama, cauliflower, navy or cannelloni beans, parsnips\nFresh fruits and veggies that are in season can be easier on your food budget. And remember that frozen produce is just as nutrient-packed as fresh and often can be more affordable.\nStart your plate painting with these easy, colorful and summery recipes.\nGrilled Fruit Chunks\nCut peaches, pears, apples, pineapple or a combination of these fruits into chunks. Toss with a little canola oil, sprinkle with cinnamon and thread onto skewers. Wrap in foil and grill over low heat for 3 to 5 minutes.\nPasta Primavera\nCook whole-grain pasta. Steam cut-up broccoli, cauliflower, carrots and green peas. Stir in chunks of fresh tomatoes and torn-up fresh basil. spoon the veggies over the pasta. Drizzle with a little light or no-calorie Italian dressing and sprinkle with Parmesan cheese.\nRose Prissel, MS, RDN, LD, is a dietitian at Mayo Clinic working in pediatric and adult nutrition, with a focus on preventive care, sports nutrition and weight management.\nAbout Mayo Clinic\nEmployees\nFind a job\nTwitter\nFacebook\nPinterest\nYouTube\nMayo Clinic is a not-for-profit organization. Make a donation.\nPatient Care & Health Info\nHealthy Lifestyle\nSymptoms A-Z\nDiseases & Conditions A-Z\nTests & Procedures A-Z\nDrugs & Supplements A-Z\nAppointments\nPatient & Visitor Guide\nPatient Online Services\nDepartments & Centers\nDoctors & Medical Staff\nMedical Departments & Centers\nResearch Centers & Programs\nAbout Mayo Clinic\nContact Mayo Clinic\nResearch\nExplore Research Labs\nFind Clinical Trials\nResearch Faculty\nPostdoctoral Fellowships\nDiscovery's Edge Magazine\nSearch Publications\nTraining Grant Positions\nEducation\nMayo Clinic Alix School of Medicine\nMayo Clinic School of Graduate Medical Education\nMayo Clinic School of Continuous Professional Development\nMayo Clinic School of Health Sciences\nMayo Clinic Graduate School of Biomedical Sciences\nAlumni Center\nFor Medical Professionals\nProvider Relations\nOnline Services for Referring Physicians\nVideo Center\nPublications\nMayo Medical Laboratories\nProducts & Services\nHealthy Living Program\nMayo Clinic Press\nMayo Clinic Health Letter\nMedical Products\nPopulation Health and Wellness Programs\nHealth Plan Administration\nMedical Laboratory Services\nAny use of this site constitutes your agreement to the Terms and Conditions and Privacy Policy linked below.\nTerms and Conditions\nPrivacy Policy\nNotice of Privacy Practices\nNotice of Nondiscrimination\nA single copy of these materials may be reprinted for noncommercial personal use only. \"Mayo,\" \"Mayo Clinic,\" \"MayoClinic.org,\" \"Mayo Clinic Healthy Living,\" and the triple-shield Mayo Clinic logo are trademarks of Mayo Foundation for Medical Education and Research\n\u00a9 1998-2023 Mayo Foundation for Medical Education and Research (MFMER). All rights reserved.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/5fdd0def-16c4-4f99-b821-5f7fb0b3d6be", "content_hash": "b7c1d796b91ee3898d810082549db631e6d58135adcef61c334c2cbe09e832b5", "created_at": "2026-03-28T05:10:40.719559210Z"}
{"id": "809789b3-153d-40ac-a095-3b70262fd53c", "source": "brain", "text": "SLC6A19 gene: MedlinePlus Genetics\n\nSLC6A19 gene: MedlinePlus Genetics\nSkip navigation\nAn official website of the United States government\nHere\u2019s how you know\nHere\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nLocked padlock icon ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nNational Library of Medicine\nMenu\nHealth Topics\nDrugs & Supplements\nGenetics\nMedical Tests\nMedical Encyclopedia\nAbout MedlinePlus\nSearch\nSearch MedlinePlus\nGO\nAbout MedlinePlus\nWhat's New\nSite Map\nCustomer Support\nHealth Topics\nDrugs & Supplements\nGenetics\nMedical Tests\nMedical Encyclopedia\nYou Are Here:\nHome \u2192\nGenetics \u2192\nGenes \u2192\nSLC6A19 gene\nURL of this page: https://medlineplus.gov/genetics/gene/slc6a19/\nSLC6A19 gene\nsolute carrier family 6 member 19\nTo use the sharing features on this page, please enable JavaScript.\nNormal Function\nThe SLC6A19 gene provides instructions for making a protein called system B(0) neutral amino acid transporter 1 (B0AT1). This protein transports certain protein building blocks (amino acids), namely those with a neutral charge, into cells. B0AT1 is found primarily in the membrane of intestinal cells that make up the brush border, which lines the walls of the intestine and absorbs nutrients from food. B0AT1 transports the neutral amino acids from food into intestinal cells; from there the amino acids are released into the bloodstream to be used by the body. B0AT1 is also found in the membrane of kidney cells, specifically in cells of the proximal tubules, which are structures that help to reabsorb nutrients and other materials into the blood and excrete unneeded substances into the urine. In the kidneys, B0AT1 reabsorbs neutral amino acids into the bloodstream so they are not released in urine.\nHealth Conditions Related to Genetic Changes\nHartnup disease\nAt least 23 mutations in the SLC6A19 gene have been found to cause Hartnup disease. This condition is characterized by increased levels of amino acids in the urine (aminoaciduria). Some individuals have episodes during which they exhibit skin rashes or movement or cognitive problems. Most of the mutations that cause Hartnup disease change single amino acids in the B0AT1 protein, reducing its activity. A mutation that has been identified in multiple affected families replaces the amino acid aspartic acid with the amino acid asparagine at position 173 in the protein (written as Asp173Asn or D173N).\nThe reduced B0AT1 activity leads to large amounts of neutral amino acids being removed from the body as waste. As a result, affected individuals are lacking (deficient) in certain amino acids and vitamins. Most affected people get the nutrients they need from a well-balanced diet. However, some individuals are nutrient-deficient due to their diet, illness, stress, or a variety of other reasons and can develop skin rashes or movement or psychiatric problems. Researchers believe that many of these features are related to a deficiency of vitamin B3 (niacin) and one of its main components, the amino acid tryptophan.\nMore About This Health Condition\nOther Names for This Gene\nB0AT1\nHND\nsodium-dependent amino acid transporter system B0\nsodium-dependent neutral amino acid transporter B(0)AT1\nsolute carrier family 6 (neutral amino acid transporter), member 19\nsystem B(0) neutral amino acid transporter AT1\nsystem B0 neutral amino acid transporter\nAdditional Information & Resources\nTests Listed in the Genetic Testing Registry\nTests of SLC6A19\nScientific Articles on PubMed\nPubMed\nCatalog of Genes and Diseases from OMIM\nSOLUTE CARRIER FAMILY 6 (NEUROTRANSMITTER TRANSPORTER), MEMBER 19; SLC6A19\nGene and Variant Databases\nNCBI Gene\nClinVar\nReferences\nAzmanov DN, Rodgers H, Auray-Blais C, Giguere R, Bailey C, Broer S, Rasko JE, Cavanaugh JA. Persistence of the common Hartnup disease D173N allele in populations of European origin. Ann Hum Genet. 2007 Nov;71(Pt 6):755-61. doi: 10.1111/j.1469-1809.2007.00375.x. Epub 2007 Jun 7. Citation on PubMed\nBroer S. The role of the neutral amino acid transporter B0AT1 (SLC6A19) in Hartnup disorder and protein nutrition. IUBMB Life. 2009 Jun;61(6):591-9. doi: 10.1002/iub.210. Citation on PubMed\nCamargo SM, Singer D, Makrides V, Huggel K, Pos KM, Wagner CA, Kuba K, Danilczyk U, Skovby F, Kleta R, Penninger JM, Verrey F. Tissue-specific amino acid transporter partners ACE2 and collectrin differentially interact with hartnup mutations. Gastroenterology. 2009 Mar;136(3):872-82. doi: 10.1053/j.gastro.2008.10.055. Epub 2008 Oct 29. Citation on PubMed\nKleta R, Romeo E, Ristic Z, Ohura T, Stuart C, Arcos-Burgos M, Dave MH, Wagner CA, Camargo SR, Inoue S, Matsuura N, Helip-Wooley A, Bockenhauer D, Warth R, Bernardini I, Visser G, Eggermann T, Lee P, Chairoungdua A, Jutabha P, Babu E, Nilwarangkoon S, Anzai N, Kanai Y, Verrey F, Gahl WA, Koizumi A. Mutations in SLC6A19, encoding B0AT1, cause Hartnup disorder. Nat Genet. 2004 Sep;36(9):999-1002. doi: 10.1038/ng1405. Epub 2004 Aug 1. Citation on PubMed\nSeow HF, Broer S, Broer A, Bailey CG, Potter SJ, Cavanaugh JA, Rasko JE. Hartnup disorder is caused by mutations in the gene encoding the neutral amino acid transporter SLC6A19. Nat Genet. 2004 Sep;36(9):1003-7. doi: 10.1038/ng1406. Epub 2004 Aug 1. Citation on PubMed\nGenomic Location\nThe SLC6A19 gene is found on chromosome 5.\nRelated Health Topics\nGenes and Gene Therapy\nGenetic Disorders\nMEDICAL ENCYCLOPEDIA\nGenes\nGenetics\nUnderstanding Genetics\nWhat is DNA?\nWhat is a gene?\nWhat is a gene variant and how do variants occur?\nDisclaimers\nMedlinePlus links to health information from the National Institutes of Health and other federal government agencies. MedlinePlus also links to health information from non-government Web sites. See our disclaimer about external links and our quality guidelines.\nThe information on this site should not be used as a substitute for professional medical care or advice. Contact a health care provider if you have questions about your health.\nLearn how to cite this page\nAbout MedlinePlus\nWhat's New\nSite Map\nCustomer Support\nSubscribe to RSS\nConnect with NLM\nNLM Web Policies\nCopyright\nAccessibility\nGuidelines for Links\nViewers & Players\nHHS Vulnerability Disclosure\nMedlinePlus Connect for EHRs\nFor Developers\nNational Library of Medicine 8600 Rockville Pike, Bethesda, MD 20894 U.S. Department of Health and Human Services National Institutes of Health\nLast updated May 1, 2016", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/809789b3-153d-40ac-a095-3b70262fd53c", "content_hash": "fa4bb4327cab2d31740bfb339f2a3e5949c430ecb6db05c76a589a373031f1a6", "created_at": "2026-03-28T05:10:40.580884068Z"}
{"id": "2dcc9412-c9a6-4d97-bab5-e03c7c585962", "source": "brain", "text": "Tubular wells and wells in general, as a source of water supply for domestic purposes - Digital Collections - National Library of Medicine\n\nTubular wells and wells in general, as a source of water supply for domestic purposes - Digital Collections - National Library of Medicine\nSkip to search Skip to main content\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\nTubular wells and wells in general, as a source of water supply for domestic purposes\nTubular wells and wells in general, as a source of water supply for domestic purposes\nCollection:\nMedicine in the Americas, 1610-1920\nAuthor(s):\nHoadley, J. C. (John Chipman), 1818-1886 author\nPublication:\n[Boston?] : [publisher not identified], [1884?]\nLanguage(s):\nEnglish\nFormat:\nText\nSubject(s):\nWater Wells\nCopyright:\nThe National Library of Medicine believes this item to be in the public domain. (More information)\nExtent:\n36 pages, 10 leaves of plates (some folded)\nIllustrations:\nIllustrations and Plates\nNLM Unique ID:\n101190994 (See catalog record)\nOCLC no.:\n53091334\nPermanent Link:\nhttp://resource.nlm.nih.gov/101190994\nView Book\nDownload\nBook (PDF) OCR (Text) Metadata (Dublin Core)\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/2dcc9412-c9a6-4d97-bab5-e03c7c585962", "content_hash": "7c924321ecfe091de46458e98c683a19a30fcc975001b092b48e0760dad9e054", "created_at": "2026-03-28T05:10:40.496728879Z"}
{"id": "46999947-2237-4c1d-a139-b02b8750d89d", "source": "brain", "text": "Models \u2013 Hugging Face\n\nModels \u2013 Hugging Face\nHugging Face\nModels\nDatasets\nSpaces\nCommunity\nDocs\nEnterprise\nPricing\nLog In\nSign Up\nEdit Models filters\nMain\nTasks\nLibraries\nLanguages\nLicenses\nOther 1\nApps\nllama.cpp\nLM Studio\nJan\nDraw Things\nDiffusionBee\nJellybox\nJoyFusion\nLocalAI\nvLLM\nOllama\nMLX LM\nDocker Model Runner\nLemonade\nSGLang\nInference Providers\nSelect all\nGroq\nNovita\nCerebras\nSambaNova\nNscale\nfal\nHyperbolic\nTogether AI\nFireworks\nFeatherless AI\nZai\nReplicate\nCohere\nScaleway\nPublic AI\nOVHcloud AI Endpoints\nHF Inference API\nWaveSpeed\nMisc\nReset Misc\nbigcode/starcoderdata\nInference Endpoints\ntext-generation-inference\nEval Results (legacy)\ntext-embeddings-inference\nMerge\n4-bit precision\ncustom_code\n8-bit precision\nMixture of Experts\nCarbon Emissions\nEval Results\nApply filters\nModels\n869\nFull-text search\nInference Available\nEdit filters\nSort: Trending\nActive filters: bigcode/starcoderdata\nClear all\nTinyLlama/TinyLlama-1.1B-Chat-v1.0\nText Generation \u2022 1B \u2022 Updated Mar 17, 2024 \u2022 1.63M \u2022 1.52k\nBlinkDL/rwkv7-g1\nText Generation \u2022 Updated 6 days ago \u2022 162\nor4cl3ai/Aiden_t5\nText Generation \u2022 Updated Oct 6, 2023 \u2022 874 \u2022 20\nTheBloke/TinyLlama-1.1B-Chat-v1.0-GGUF\n1B \u2022 Updated Dec 31, 2023 \u2022 118k \u2022 211\nBSC-LT/ALIA-40b\nText Generation \u2022 40B \u2022 Updated Oct 22, 2025 \u2022 94 \u2022 88\nBlinkDL/rwkv-7-world\nText Generation \u2022 Updated May 31, 2025 \u2022 107\nJetBrains/Mellum-4b-dpo-all-gguf\n4B \u2022 Updated Oct 1, 2025 \u2022 151 \u2022 5\nTheBloke/TinyLlama-1.1B-Chat-v0.3-AWQ\nText Generation \u2022 1B \u2022 Updated Nov 9, 2023 \u2022 81.6k \u2022 4\ncroissantllm/CroissantLLMChat-v0.1-GGUF\nText Generation \u2022 1B \u2022 Updated Apr 29, 2024 \u2022 71 \u2022 4\nibm-granite/granite-34b-code-base-8k\nText Generation \u2022 34B \u2022 Updated Sep 2, 2024 \u2022 58 \u2022 20\nJetBrains/Mellum-4b-base\nText Generation \u2022 4B \u2022 Updated May 7, 2025 \u2022 2.24k \u2022 436\nJetBrains/Mellum-4b-sft-python\nText Generation \u2022 4B \u2022 Updated May 19, 2025 \u2022 24 \u2022 55\nJetBrains/Mellum-4b-base-gguf\n4B \u2022 Updated May 7, 2025 \u2022 503 \u2022 38\nmicrosoft/NextCoder-32B\nText Generation \u2022 33B \u2022 Updated Jun 12, 2025 \u2022 258 \u2022 \u2022 67\nJetBrains/Mellum-4b-sft-kotlin\nText Generation \u2022 4B \u2022 Updated May 19, 2025 \u2022 45 \u2022 21\nmradermacher/NextCoder-7B-GGUF\n8B \u2022 Updated Jul 13, 2025 \u2022 150 \u2022 3\nmlx-community/salamandra-7b-instruct-mlx-bf16\nText Generation \u2022 Updated Aug 21, 2025 \u2022 12 \u2022 1\nJetBrains/Mellum-4b-dpo-python-gguf\n4B \u2022 Updated Oct 1, 2025 \u2022 63 \u2022 4\nmradermacher/Mellum-4b-dpo-all-i1-GGUF\n4B \u2022 Updated Dec 6, 2025 \u2022 185 \u2022 1\nSalesforce/codegen25-7b-mono_P\nText Generation \u2022 Updated Jan 31, 2025 \u2022 124 \u2022 31\nopenlm-research/open_llama_7b_v2\nText Generation \u2022 Updated Jul 7, 2023 \u2022 1.91k \u2022 122\nSalesforce/codegen25-7b-instruct_P\nText Generation \u2022 Updated Jan 31, 2025 \u2022 39 \u2022 37\nSalesforce/codegen25-7b-multi_P\nText Generation \u2022 Updated Jan 31, 2025 \u2022 351 \u2022 139\nopenlm-research/open_llama_7b_v2_easylm\nUpdated Jul 7, 2023 \u2022 4\nopenlm-research/open_llama_3b_v2\nText Generation \u2022 Updated Jul 16, 2023 \u2022 18.1k \u2022 160\nopenlm-research/open_llama_3b_v2_easylm\nUpdated Jul 16, 2023 \u2022 4\nTheBloke/Codegen25-7B-mono-GPTQ\nText Generation \u2022 7B \u2022 Updated Aug 21, 2023 \u2022 4 \u2022 8\njamesdborin/ct2-int8-open-llama-7b-v2\nText Generation \u2022 Updated Jul 26, 2023 \u2022 1\nBlinkDL/rwkv-5-world\nText Generation \u2022 Updated Apr 3, 2024 \u2022 269\nstabilityai/stablecode-completion-alpha-3b\nText Generation \u2022 Updated Aug 8, 2023 \u2022 44 \u2022 117\nPrevious\n1\n2\n3\n...\n29\nNext\nSystem theme\nCompany\nTOS Privacy About Careers\nWebsite\nModels Datasets Spaces Pricing Docs", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/46999947-2237-4c1d-a139-b02b8750d89d", "content_hash": "6fcde4e475fe3f5c72b5ae201a83bda3befc8ac872ab0f7df874e6ba548780f5", "created_at": "2026-03-28T05:10:40.491447659Z"}
{"id": "d9e7dbff-7833-43c6-8b39-2784e125e224", "source": "brain", "text": "Subjects: House Calls - Digital Collections - National Library of Medicine Search Results\n\nSubjects: House Calls - Digital Collections - National Library of Medicine Search Results\nSkip to search Skip to main content Skip to first result\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\nSearch\nSearch Constraints\nStart Over You searched for: Subjects House Calls \u2716 Remove constraint Subjects: House Calls\n1 - 14 of 14\nSort by relevance\nrelevance title\nNumber of results to display per page\n50 per page per page\n10 per page 20 per page 50 per page 100 per page\nSearch Results\n1. A simple device for sterilizing in private houses\nAuthor(s):\nAshton, William Easterly, 1859-1933 author\nPublication:\n[Philadelphia?] : [publisher not identified], [1894?]\nSubject(s):\nSterilization -- instrumentation\nHouse Calls\n2. Bringing primary care home: the Medical House Call Program at MedStar Washington Hospital Center\nAuthor(s):\nKlein, Sarah, author\nHostetter, Martha, author\nMcCarthy, Douglas, author\nPublication:\n[New York, N.Y.] : Commonwealth Fund, July 2016\nSubject(s):\nAmbulatory Care -- methods\nHealth Services for the Aged\nHealth Services Needs and Demand\nHouse Calls\nPrimary Health Care\nUnited States\n3. Maintenance of an aseptic technique in gynecological operations outside of hospitals\nAuthor(s):\nRobb, Hunter, 1863-1940 author\nPublication:\n[Baltimore?] : [publisher not identified], [1893?]\nSubject(s):\nGynecologic Surgical Procedures\nAsepsis -- methods\nHouse Calls\n4. Antiseptic surgery in the country\nAuthor(s):\nWheeler, John Brooks, 1853-1942\nPublication:\nPhiladelphia : Medical Press Co., 1889\nSubject(s):\nSurgical Procedures, Operative\nAntisepsis\nHouse Calls\n5. Surgery on the wing: three successful abdominal sections\nAuthor(s):\nLong, John Wesley, 1859-1926 author\nPublication:\n[Charlotte?] : [publisher not identified], [1895?]\nSubject(s):\nAppendicitis -- surgery\nOvarian Cysts -- surgery\nAdnexal Diseases -- surgery\nHouse Calls\n6. [Teddy bears dressed as a nurse, a doctor, and a patient]\nAuthor(s):\nNeave, Jeremy, photographer\nPublication:\nWaddesdon, Bucks. : Perspectives Photographics, [between 1950 and 1999?]\nSubject(s):\nNurses\nHouse Calls\nPhysicians\nPlay and Playthings\nEngland\n7. Answering the call: when you are sick send for the Metropolitan nurse\nPublication:\nNew York : Metropolitan Life Insurance Company, [between 1900 and 2000]\nSubject(s):\nNurses\nHouse Calls\nInsurance, Life\nUnited States\n8. Wintry days offer no obstacles to the nurse in the perfomrance of her duties\nPublication:\n[Scotland?] : [publisher not identified], [1927?]\nSubject(s):\nNurses\nHouse Calls\n9. [Services of a Queen's nurse for the aged]\nPublication:\nLondon : Raphael Tuck & Sons, [between 1900 and 1950]\nSubject(s):\nNurses\nGeriatric Nursing\nHealth Services for the Aged\nHouse Calls\nEngland\n10. [Nurse helping a young girl]\nPublication:\nLondon : Raphael Tuck & Sons, [1927?]\nSubject(s):\nNurses\nHouse Calls\n11. His first case\nAuthor(s):\nDrayton, Grace G. (Grace Gebbie) artist\nPublication:\nHamburg : Alfred Schweizer, [1910?]\nSubject(s):\nChild, Preschool\nHouse Calls\nNurses\nPlay and Playthings\n12. A queen's nurse on her village round\nPublication:\nLondon : Raphael Tuck & Sons, [1927?]\nSubject(s):\nNurses\nHouse Calls\n13. Sight tests at home\nPublication:\n[England] : H.M.S.O., 1990\nSubject(s):\nVision Tests\nEligibility Determination\nHouse Calls\nState Medicine\nUnited Kingdom\n14. \"A Doctor Quick!\"\nPublication:\n[United States] : Bell Telephone, [1905?]\nSubject(s):\nTelephone\nHouse Calls\nAmerican Telephone and Telegraph Company.\nRefine by:\nShow facets Hide facets\nFormats\nStill image9\nText5\nCollections\nImages from the History of Medicine (IHM)9\nMedicine in the Americas, 1610-19204\nHealth Policy and Services Research1\nSubjects\nHouse Calls\u2716[remove]14\nNurses7\nEngland2\nHealth Services for the Aged2\nPlay and Playthings2\nmore Subjects \u00bb\nAuthors\nAshton, William Easterly, 1859-1933 author1\nDrayton, Grace G. (Grace Gebbie) artist1\nHostetter, Martha, author1\nKlein, Sarah, author1\nLong, John Wesley, 1859-1926 author1\nmore Authors \u00bb\nTitles\n\"A Doctor Quick!\"1\nA queen's nurse on her village round1\nA simple device for sterilizing in private houses1\nAnswering the call: when you are sick send for the Metropolitan nurse1\nAntiseptic surgery in the country1\nmore Titles \u00bb\nLanguages\nEnglish14\nGenre\nPostcard8\nAdvertisement1\nCase Reports1\nPoster1\nTechnical Report1\nCopyright\nPublic domain8\nCopyright may apply7\nDates by Range\n1850-18994\n1900-19497\n1950-19993\n2000 and later2\nPublication Year\nBegin\nEnd\n1000 to 10990\n1100 to 11990\n1200 to 12990\n1300 to 13990\n1400 to 14990\n1500 to 15990\n1600 to 16990\n1700 to 17990\n1800 to 18994\n1900 to 19999\n2000 to 20261\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/d9e7dbff-7833-43c6-8b39-2784e125e224", "content_hash": "0620c0d7214ec28d0731a76e099f322e97741ea8d4060d84870190b92da33596", "created_at": "2026-03-28T05:10:40.491434252Z"}
{"id": "181873be-758b-4575-bfcb-d727430491ad", "source": "brain", "text": "Anastrozole \u2014 Community Discussion Forums\n\nAnastrozole \u2014 Community Discussion Forums\nHome\u203a The Breastcancer.org Community Forum\u203a In treatment\u203a Hormonal Therapy - Before, During, and After\nCome join others currently navigating treatment in our weekly Virtual Support Groups! See times and register here.\nAnastrozole\nlmruss Posts: 1\nApril 2025 edited April 2025 in Hormonal Therapy - Before, During, and After\nHi. looking for opinions. I was diagnosed with invasive carcinoma of breast the breast. My tumor was 4mm. I was HER negative. Estrogen Receptor 60%, Progesterone Receptor 40%, KI67 proliferation no longer marker 3%. I had a lumpectomy. When they did the surgery the tumor was already gone from the biopsy. Nothing spread to my lymph nodes They didn\u2019t do testing for an onco type score because it was too small & the tumor was gone during the surgery. I did 20 rounds of radiation. Would you do the hormone therapy in this situation? My genetic testing also came back good . Really trying to decide what to do. Any feedback is greatly appreciated!\nTagged:\nArimidex (anastrozole)\n0\nComments\nexbrnxgrl Posts: 5,613\nApril 2025\nImruss,\nThis question comes up a lot. My first suggestion is to bring your concerns about this to your mo and really be honest about why you\u2019re hesitating. Genetic testing is largely irrelevant since only a minority of bc cases are linked to genetic mutations. What they\u2019re recommending, Anastrozole, is pretty much standard of care for your situation.\nWhen reading through bco you are much more likely to find posts by folks having problems and side effects from AI\u2019s. Those who have no, few, or diminishing side effects tend not to post nearly as much. Lastly, there is simply no way to predict in advance who will or won\u2019t have side effects or the severity. I took each of the AI\u2019s at one time or another for well over 12 years but managed the side effects for the most part ( about to start again, too!). Many people choose to start and are surprised by how well things go, others, not so much so they choose to stop.\nFor me, the bottom line when asking this question is if you will feel regret if you don\u2019t take it and have a recurrence later. Clearly this is a very individual choice but it is always your choice. Take care\n0\nmoderators Posts: 9,847\nApril 2025\nHi <USER_36>, and welcome to Breastcancer.org!\nWe're so sorry for the reasons that bring you here, but we're really glad you've found us. As you can already see, our community is a wonderful source of advice, information, encouragement, and support \u2014 we're all here for you!\n<USER_37> offers a great response, and some information to ponder.\nThere's also some good insight here, to explain why it's beneficial to take hormonal therapy to prevent recurrence risk:\nhttps://www.breastcancer.org/treatment/hormonal-therapy/refusing-hormone-therapy\nWe hope this helps!\n\u2014The Mods\n0\nsundevilfan68 Posts: 2\nApril 2025\nI take anastrozole. I am in a similar situation. I had what was said to be 8mm ER+ PR- HER2- ILC, but was 4mm after biopsy. I had a lumpectomy and brachytherapy (targeted radiation) no chemo. No cancer in my lymph nodes. Nothing showed up on genetic testing. I don't like the side effects of the medication, but they are not enough to make me stop the med. I know that I want to do all I can do to lessen my risk of recurrence. You could always try it out and if the side effects are too much, switch the med or discontinue at that time.\n0\nCategories\nAll Categories\n1.4K Concerned about my risk\n1.7K Connect with others like me\n2K In treatment\n606 Managing life with cancer\n156 Finished treatment\n836 Living with metastatic disease\n53 Caring for someone\n294 Tributes\n39 Discussion forum resources\nJoin Us on Zoom: Upcoming virtual support groups. Read more...\nShare more about you! Fill out your profile.\nYour donation goes directly to what you read, hear, and see on Breastcancer.org.\nDonate\nStay informed with emails from us\nBy submitting my email, I agree to receive newsletters from Breastcancer.org\nAbout Us\nMission Team Media Financials\nGet In Touch\nContact us Job postings FAQ Guidelines Abbreviations\nYou can help\nWays to give Donate Host a fundraiser Partnerships\nF O U R - S T A R Breastcancer.org is a registered 501(c)(3) nonprofit organization.\nEIN is 23-3082851.\n\u00a9 2025 Breastcancer.org - All rights reserved. 40 E Montgomery Avenue, 4th Floor Ardmore, PA 19003. Breastcancer.org does not provide medical advice, diagnosis or treatment. See additional information.\nPolicies|\nPrivacy|\nTerms of Use|", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/181873be-758b-4575-bfcb-d727430491ad", "content_hash": "8b196192502a8a5ea4dd8070ca6fca82d505f43c98aae7ada61413e616319b35", "created_at": "2026-03-28T05:10:40.491350944Z"}
{"id": "e780404d-5519-454a-9ae3-d1b9ca63a036", "source": "brain", "text": "John MacLeod - FightCRC\n\nJohn MacLeod - FightCRC\nSkip to content\nPatients & Caregivers\nAbout Colorectal Cancer\nOur Programs\nGet Involved\nSearch Results:\nWhat are my screening options? Just Diagnosed \u2013 Where do I go from here? Dealing with Skin Rash and other Unpleasant Side Effects Report Cards: Understanding Your Biomarker and Pathology Reports View More Results\nDonate Now\nPatients & Caregivers\nAccess the information, tools, and support that help you move through colorectal cancer and stay informed at every step.\nLearn More\nUnderstanding Your Diagnosis\nBreak down the details of your diagnosis, including staging, testing, and treatment options, to help you navigate what comes next.\nLearn More\nTreatment Choices & Checklist\nColorectal Cancer Biomarkers\nUpcoming Webinars\nPatient & Caregiver Stories\nCancer Terms Glossary\nEducation & Resources\nExplore reliable resources, expert guidance, and practical tools to help you learn more and advocate for your health with confidence.\nLearn More\nJust Diagnosed\nYour Care Team\nSurgery & Ostomy\nDiagnostic Tests & Scans\nTreatment Choices & Checklist\nClinical Trials\nSide Effects\nMental Health\nLifestyle & Nutrition\nFinancial & Insurance Help\nPlanning Ahead & End of Life\nSurvivorship\nSupport Services\nFight CRC\u2019s support services provide the tools, guidance, and community you need to stay informed, supported, and empowered every step of the way.\nLearn More\nJoin the Online Community\nFind a Doctor\nAsk ChatCRC\nSupport for Caregivers\nLGBTQ+ Support\nColorectal Cancer in Young Adults\nPartner Organization Resources\nEstate Planning\nAbout Colorectal Cancer\nLearn what colorectal cancer is, how it develops, and the key facts, symptoms, and screening guidelines to know.\nLearn More\nColorectal Cancer Facts\nGet the key facts about colorectal cancer\u2014including who\u2019s affected, why rates are rising in younger adults, and what we know from the latest research and data.\nLearn More\nWhat is Colorectal Cancer?\nStatistics\nHow Colorectal Cancer Develops\nYour Risk & Prevention Tips\nUnderstand how your personal history, family history, and other risk factors influence your chances of developing colorectal cancer\u2014and learn the steps you can take to stay ahead of it.\nLearn More\nGenetics & Family History\nSigns & Symptoms\nScreening Quiz\nScreening & Early Detection\nGet clear guidance on screening and early detection: which tests are right for you, when to schedule them, how to prepare for a colonoscopy, and insurance coverage.\nLearn More\nWhich Test & When\nColonoscopy Prep\nInsurance & Screening Coverage Guide\nOur Programs\nExplore Fight CRC programs that support you, strengthen your voice, and connect you to research-driven progress.\nLearn More\nAdvocacy\nOur Advocacy Program helps you raise your voice, take meaningful action, and advance Fight CRC\u2019s priorities to improve colorectal cancer outcomes.\nLearn More\nTake Action\nAdvocacy News & Wins\nPolicy Priorities\nColorectal Cancer Care Initiative\nAnnual Lobby Day\nAdvocacy Training\nState Catalyst Program\nResearch\nThe Research Program fuels collaboration and patient-centered research to improve outcomes across colorectal cancer care.\nLearn More\nResearch Priorities\nFunded Researchers\nClinical Trials\nResearch Advocacy Training & Support Program\nOur Path to a Cure\nEvents & Campaigns\nDiscover upcoming Fight CRC events and opportunities to connect, learn, and take action.\nLearn More\nCall-on Congress\nUnited in Blue\nAmbassador Program\nColon Camp\nNo Shave November\nMarch: Colorectal Cancer Awareness Month\nGet Involved\nWhether you\u2019re a patient, caregiver, or loved one, Fight CRC offers medically-reviewed resources, support, and community so you never face colorectal cancer alone.\nLearn More\nEvents & Ways to Give\nExplore upcoming events and discover meaningful ways to support Fight CRC\u2019s mission.\nLearn More\nHonor Your Loved One\nHost an Event\nJoin an Event\nSupport a Survivor\nFind Community\nLearn More\nJoin the Online Community\nVolunteer\nShare Your Story\nRaise Awareness From Home\nTake Action\nShop\nLearn More\nOur Mission\nNews & Media Hub\nOur Team\nContact Us\nShop\nImpact & Financials\nJohn MacLeod\nLove and miss you every minute of every day\nREADY TO JOIN THE FIGHT?\nSubscribe To Our Newsletter Join Our Community\nOur Mission\nNews & Media Hub\nOur Team\nContact Us\nShop\nImpact & Financials\nFaceboook X Instagram YouTube TikTok LinkedIn Bluesky\nPolicies and Disclaimers\n\u00a9 2026 Fight Colorectal Cancer. All rights reserved. Tax ID: 20-2622550\nDonate Now", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/e780404d-5519-454a-9ae3-d1b9ca63a036", "content_hash": "af77ece289bf83ed0c370d8de207b1cbf3d249289a08efe28a798beb59ce4334", "created_at": "2026-03-28T05:10:40.482846011Z"}
{"id": "a6a0516e-3fab-463c-8aad-0c91c7580d25", "source": "brain", "text": "Has anyone had surgery to remove scar tissue? | Mayo Clinic Connect\n\nHas anyone had surgery to remove scar tissue? | Mayo Clinic Connect\nSkip to Content\nConnect\nSign In\nJoin\nHome\nSupport Groups\nBlogs & Podcasts\nEvents\nMembers\nHelp Center\n< Head & Neck Cancer\nHas anyone had surgery to remove scar tissue?\nPosted by mindyt <USER_13>, Oct 24, 2021\nI have a lot of scar tissue from radiation leaving me with a challenged airway - it has also ratcheted down on my vocal cords taking my voice as well as painful- I live in an area that the Drs tell me to find a specialist (it\u2019s over their heads) but the idea that I could have improvement would be incredible. I have been seen by 2 ENT surgeons in my state but I don\u2019t think the information was there. So has anyone surviving throat cancer had radiation and surgery to remove scar tissue or anyone with some advice I don\u2019t know where to go from here?\nLike\nHelpful\nHug\n5 Reactions\nCopy link to clipboard\nBookmark\nReport discussion\nInterested in more discussions like this? Go to the Head & Neck Cancer Support Group.\nFirst\n1\n2\n3\n4\n...\nNext\nLast\nOldest to Newest Newest to Oldest Most Replied To Most Reacted\nstephenrfleury | <USER_14> | 2 days ago\nI was treated for my SCC with radiation and chemo. Like many of us, the radiation caused fibrosis and tightening in my neck. To ease the fibrosis and to return some of the mobility, I had a surgery called fat grafting. Prior to the surgery, I began Botox injections in my neck, which which helped on their own. Then I had the fat grafting surgery where they remove fat, in my case my stomach, and inject it into my neck. During that surgery, they also \"cut \"some some of the fibrous chords in my neck. The net result of these two treatments is near normal movement in my neck, and almost no pain.\nLike\nHelpful\nHug\n5 Reactions\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\nomaest | <USER_15> | 3 days ago\nI have radiation fibrosis as a result of treatment for tonsil cancer in 2003. This is one of many long term after effects of radiation. The ENT of my tumor team told me that surgery was too much of a risk because of where the scar tissue (fibrosis) is and if removal surgery was done it probably wouldn't heal. The side of my neck is very hard. I have lots of exercises to do and have gone to a number of therapists to keep the tissue from getting stiffer as the years go by.\nLike\nHelpful\nHug\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\ndoglover888 | <USER_16> | 4 days ago\nHi. This might help. I had esophageal cancer and due to complications my right vocal cord died. I had an implement inserted in my next which produces sound. This could be an option. Good luck and stay positive.\nLike\nHelpful\nHug\n3 Reactions\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\nharleytiger | <USER_17> | Dec 2, 2025\nIn reply to <USER_18> \"<USER_19> wow that\u2019s a lot to take in. My worst 19 hour neck dissections made my...\" + (show)- (hide)\n<USER_18>\n<USER_19> wow that\u2019s a lot to take in. My worst 19 hour neck dissections made my mobility like a wooden neck. I\u2019m only comfortable resting my head from so much muscle loss but knitting has become my best friend.\nJump to this post\n<USER_18> Me too. I have the same problem. My neck feels like I have a bungee chord attached from my skull to my top rib. I have hard places in there as well. Mobility is a big problem. Did you have radiation? I think mine is radiation fibrosis. I'm currently going to a great PT who is doing great work on my neck. He believes he can make it much better. Hopefully he's right? I know he works it very well. He said red light hasn't been proven to work and the cost of those machines are so expensive that most PT locations don't have them.\nLike\nHelpful\nHug\n3 Reactions\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\nspeseas | <USER_18> | Dec 1, 2025\nIn reply to <USER_19> \"Dear <USER_13>, I have had radiation for Pyriform Sinus Cancer. These two pouches, are located down...\" + (show)- (hide)\n<USER_19>\nDear <USER_13>, I have had radiation for Pyriform Sinus Cancer. These two pouches, are located down by the vocal cords. My pen-pal friend has also had radiation for throat cancer. We both suffer in different ways. Your question about surgery to remove scar tissue is a good one. Here is what we have both been told by several different ENT's: Radiated tissue can become necrotic (rot) if any type of surgery is performed. One ENT described radiated tissue as \"mush.\" Unfortunately, it can become necrotic on its own too. My friend has been on a feeding tube for over two years, as she can not eat, drink, and can barely talk. Her Epiglottis is fused to her throat from the radiation. Any tampering could produce disastrous results. We both have tracheotomies, as my Vocal Cords are paralyzed. I could barely breathe, thus, the Tracheotomy. Everyone is different, but when it comes to radiated tissue, it is a sad situation. As the doctors usually say, \"at least you are alive.\" I foresee the day when less destructive methods are utilized to cure cancer, however, it probably will not be in my lifetime, as I am in my 60s. Good luck Mindy, and know you are not alone. Stay close to our maker, and you will find peace.\nJump to this post\n<USER_19> wow that\u2019s a lot to take in. My worst 19 hour neck dissections made my mobility like a wooden neck. I\u2019m only comfortable resting my head from so much muscle loss but knitting has become my best friend.\nLike\nHelpful\nHug\n3 Reactions\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\n1 reply\ned69gts | <USER_20> | Mar 2, 2025\nAnd Iam losing my voice and having pain around my face and ear where they put a new tongue in my mouth\nLike\nHelpful\nHug\n1 Reaction\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\ned69gts | <USER_20> | Mar 2, 2025\nNo my doctor doesn't want to do anything for it\nLike\nHelpful\nHug\n1 Reaction\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\ndalestackable | <USER_21> | Jun 24, 2024\nFollow up on the small bowel obstructions/from scar tissue of feeding tube. After reviewing the 2 emergency room notes, my surgeon (Ivor Lewis surgery) suggested that I wait and if it happens again, they may go in and do some removal of scar tissue. As I am in Florida, and my surgeon is in Houston, that poses a potential threat due to the time, it would take me to get there. I\u2019m still very concerned because we know removing scar tissue can create more scar tissue.\nHas anyone had bowel obstructions following a feeding tube?\nI had mine for 6 months.\nConcerned because my local emergency room doctors are not receptive to treating me once they see my scat CAT scan and the repositioned organs of my gut. (from the Ivor Lewis surgery) I don\u2019t know how I will be able to get on the plane and go back to Houston if this happens again. Concerned about what could happen in an emergency situation if I have another bowel obstruction .\nLike\nHelpful\nHug\n1 Reaction\nCopy link to clipboard\nBookmark\nReport comment\nREPLY\ndalestackable | <USER_21> | Oct 24, 2023\nIn reply to <USER_22> \"I am a 3+ year survivor of Stage IV ESCC. I am totally non-PO due to...\" + (show)- (hide)\n<USER_22>\nI am a 3+ year survivor of Stage IV ESCC. I am totally non-PO due to extensive esophageal strictures. I've undergone 10 dilation but my esophagus is now too friable to attempt further dilations as it would repture. I am totally dependent upon my G tube for meds, nutrition and hydration. I was treated with aggressive chemo-radiation to try to control my disease. Unfortunately, one of rarely discussed side effects of radiation therapy for esophageal, throat and head and neck cancers is reactive fibrosis. While radiotherapy kills the cancer, it also produces free radical reactive oxygen species (ROS) and inflammation which cause tissue fibroblasts near the cancer lesion to produce increased amounts of connective tissue. This results in increased tissue stiffness and rigidity as well as strictures. The throat and esophagus may be amenable to dilation but the relief may be temporary as fibrosis and strictures inevita", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/a6a0516e-3fab-463c-8aad-0c91c7580d25", "content_hash": "e2cead1368126e9ea588258275cc59e16629c25fffc0ff2af384756b18dc47f4", "created_at": "2026-03-28T05:10:40.374345966Z"}
{"id": "9e8622d0-0588-45b7-9032-8294df18ba18", "source": "brain", "text": "IP video intercom kit\n\nIP video intercom kit\nThe store will not work correctly in the case when cookies are disabled.\nJavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.\nEnglish\n\u06a9\u0648\u0631\u062f\u06cc\n\u0627\u0644\u0639\u0648\u062f\u0629 \u0625\u0644\u0649 \u0622\u0633\u064a\u0627\u0633\u064a\u0644\nAuto Login\n\u062d\u0648\u0644 \u0622\u0633\u064a\u0627\u0633\u064a\u0644 \u0627\u0644\u062f\u0639\u0645\n\u0625\u0633\u062a\u0645\u0627\u0631\u0629 \u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u0634\u0631\u06a9\u0627\u0621\n\u0645\u0642\u0627\u0631\u0646\u0629 \u0627\u0644\u0645\u0646\u062a\u062c\u0627\u062a\n\u0627\u0644\u0623\u0633\u0626\u0644\u0629 \u0627\u0644\u0634\u0627\u0626\u0639\u0629\n\u0627\u0644\u0633\u064a\u0627\u0633\u0629 \u0648\u0627\u0644\u0636\u0645\u0627\u0646\nToggle Nav\n\u0642\u0627\u0626\u0645\u0629 \u0637\u0639\u0627\u0645\n\u0633\u0644\u0629 \u0627\u0644\u062a\u0633\u0648\u0642\nAuto Login\n\u0644\u063a\u0629\nEnglish\n\u06a9\u0648\u0631\u062f\u06cc\n\u0625\u0633\u062a\u0645\u0627\u0631\u0629 \u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u0634\u0631\u06a9\u0627\u0621\n\u0645\u0642\u0627\u0631\u0646\u0629 \u0627\u0644\u0645\u0646\u062a\u062c\u0627\u062a\n\u0627\u0644\u0623\u0633\u0626\u0644\u0629 \u0627\u0644\u0634\u0627\u0626\u0639\u0629\n\u0627\u0644\u0633\u064a\u0627\u0633\u0629 \u0648\u0627\u0644\u0636\u0645\u0627\u0646\n\u0622\u0633\u064a\u0627\u0645\u0648\u0644\n\u0645\u0648\u0628\u0627\u064a\u0644\n\u0627\u0644\u0642\u0633\u0627\u0626\u0645 \u0627\u0644\u0627\u0644\u0643\u062a\u0631\u0648\u0646\u064a\u0629\n\u062d\u0627\u0633\u0648\u0628\n\u0623\u0644\u0639\u0627\u0628\n\u0625\u0644\u0643\u062a\u0631\u0648\u0646\u064a\n\u0645\u0644\u062d\u0642\u0627\u062a\n\u0623\u062c\u0647\u0632\u0629 \u0645\u0646\u0632\u0644\u064a\u0629\n\u0645\u0646\u062a\u062c\u0627\u062a \u0622\u0633\u064a\u0627\u0633\u064a\u0644\n\u062d\u0633\u0627\u0628\n\u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u062f\u062e\u0648\u0644\n\u0633\u0644\u0629 \u0627\u0644\u062a\u0633\u0648\u0642\n\u064a\u0628\u062d\u062b\n\u064a\u0628\u062d\u062b\n\u064a\u0628\u062d\u062b\n\u0627\u0644\u0635\u0641\u062d\u0629 \u0627\u0644\u0631\u0626\u064a\u0633\u064a\u0629\n\u0622\u0633\u064a\u0627\u0645\u0648\u0644\n\u0627\u0644\u062d\u0645\u0627\u064a\u0629 \u0627\u0644\u0630\u0643\u064a\u0629\nHikvision\nIP video intercom kit\nClose\nThis is error message\nIP video intercom kit\n\u0645\u062a\u0648\u0641\u0631\n\u064a\u0634\u0627\u0631\u0643\n\u064a\u0634\u0627\u0631\u0643 \u064a\u0634\u0627\u0631\u0643\n\u0643\u0646 \u0623\u0648\u0644 \u0645\u0646 \u064a\u0631\u0627\u062c\u0639 \u0647\u0630\u0627 \u0627\u0644\u0645\u0646\u062a\u062c\n\u0627\u0644\u0643\u0645\u064a\u0629:\nEZVIZ\n\u0623\u0636\u0641 \u0644\u0633\u0644\u0629 \u0627\u0644\u062a\u0633\u0648\u0642\n244,950 \u062f\u064a\u0646\u0627\u0631\u200f\n\u0623\u0636\u0641 \u0644\u0644\u0645\u0642\u0627\u0631\u0646\u0629\n\u0627\u0646\u062a\u0642\u0644 \u0625\u0644\u0649 \u0627\u0644\u0646\u0647\u0627\u064a\u0629 \u0645\u0639\u0631\u0636 \u0627\u0644\u0635\u0648\u0631\n\u062a\u062e\u0637\u064a \u0625\u0644\u0649 \u0628\u062f\u0627\u064a\u0629 \u0645\u0639\u0631\u0636 \u0627\u0644\u0635\u0648\u0631\n\u0646\u0638\u0631\u0629 \u0639\u0627\u0645\u0629 \u0639\u0644\u0649 \u0627\u0644\u0645\u0646\u062a\u062c\nNetwork video intercom bundle for villa or house\nOne call button for easier calls\nConvenient Hik-Connect App mobile control\nStores messages and captured pictures in the TF card\nIncluding: DS-KV8113-WME1(C) \u00d7 1, DS-KH6320-WTE1 \u00d7 1, 4-port standard PoE switch \u00d7 1, 16 GB TF card \u00d7 1\nPower adapter included in the package\n\u0645\u0644\u0627\u062d\u0638\u0627\u062a\n\u0627\u0644\u062a\u0642\u064a\u064a\u0645\u0627\u062a \u0648\u0627\u0644\u0645\u0631\u0627\u062c\u0639\u0627\u062a\n\u0643\u0646 \u0623\u0648\u0644 \u0645\u0646 \u064a\u0631\u0627\u062c\u0639 \u0647\u0630\u0627 \u0627\u0644\u0645\u0646\u062a\u062c\n0\n0\n0\n0\n0\n\u0627\u0643\u062a\u0628 \u0645\u0631\u0627\u062c\u0639\u0629\n\u06cc\u0631\u062c\u06cc \u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u062f\u062e\u0648\u0644 \u0644\u06a9\u062a\u0627\u0628\u0629 \u0645\u0644\u0627\u062d\u0638\u0627\u062a\u0643 \u0627\u0644\u0642\u06cc\u0645\u0629 \u062d\u0648\u0644 \u0645\u0646\u062a\u062c\u0627\u062a\u0646\u0627. \u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u062f\u062e\u0648\u0644 \u0623\u0648 \u0625\u0646\u0634\u0627\u0621 \u062d\u0633\u0627\u0628\nBuy Electronics, devices & More | Asia Mall by Asiacell \u2013 Iraq's Online Shopping\n\u062a\u0645 \u0628\u064a\u0639\u0647\u0627 \u0645\u0646 \u0642\u0628\u0644\nEZVIZ\n18 Products\n\u062a\u0648\u0627\u0635\u0644 \u0645\u0639 \u0627\u0644\u0628\u0627\u0626\u0639\n\u062a\u0648\u0627\u0635\u0644 \u0645\u0639 \u0627\u0644\u0628\u0627\u0626\u0639\nClose\n\u0627\u0633\u0645\u0643 : \u0628\u0631\u064a\u062f\u0643 \u0627\u0644\u0627\u0644\u0643\u062a\u0631\u0648\u0646\u064a : \u0627\u0644\u0639\u0646\u0648\u0627\u0646 : \u0637\u0644\u0628\u0643 :\n\u0631\u0627\u0628\u0637 \u0633\u0631\u064a\u0639\n\u0627\u0644\u062f\u0641\u0639 \u0627\u0644\u0633\u0631\u064a\u0639 / \u0625\u0639\u0627\u062f\u0629 \u0627\u0644\u0634\u062d\u0646\n\u062e\u062f\u0645\u0629 \u0627\u0644\u0645\u0634\u062a\u0631\u0643\u064a\u0646\n\u0625\u0633\u062a\u0645\u0627\u0631\u0629 \u062a\u0633\u062c\u064a\u0644 \u0627\u0644\u0634\u0631\u06a9\u0627\u0621\n\u0645\u0633\u0627\u0639\u062f\u0629\n\u062d\u0633\u0627\u0628\u064a\n\u062a\u0627\u0631\u064a\u062e \u0627\u0644\u0637\u0644\u0628\u0627\u062a\n\u0627\u0644\u0639\u0646\u0627\u0648\u064a\u0646\n\u0639\u0631\u0628\u0629 \u0627\u0644\u062a\u0633\u0648\u0642\n\u0645\u0644\u0641\u064a\n\u062a\u062a\u0628\u0639 \u0637\u0644\u0628\u0643\n\u0645\u0639\u0644\u0648\u0645\u0627\u062a \u0627\u0644\u0634\u0631\u0643\u0629\n\u0627\u0644\u0634\u0631\u0648\u0637 \u0648\u0627\u0644\u0623\u062d\u0643\u0627\u0645\n\u062d\u0645\u0644 \u062a\u0637\u0628\u064a\u0642 \u0622\u0633\u064a\u0627\u0633\u064a\u0644\n\u062d\u0648\u0644 \u0622\u0633\u064a\u0627\u0633\u064a\u0644\n\u0627\u0644\u0623\u0633\u0626\u0644\u0629 \u0627\u0644\u0634\u0627\u0626\u0639\u0629\n\u0627\u0644\u0633\u064a\u0627\u0633\u0629 \u0648\u0627\u0644\u0636\u0645\u0627\u0646\n\u062d\u0645\u0644 \u062a\u0637\u0628\u064a\u0642 \u0622\u0633\u064a\u0627\u0633\u064a\u0644\n\u062c\u0645\u064a\u0639 \u062d\u0642\u0648\u0642 \u0627\u0644\u0646\u0634\u0631 \u0645\u062d\u0641\u0648\u0638\u0629 \u0644\u0622\u0633\u06cc\u0627\u0633\n\u0627\u0644\u062a\u0648\u0627\u0635\u0644 \u0645\u0639\u0646\u0627 \u0639\u0644\u0649", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/9e8622d0-0588-45b7-9032-8294df18ba18", "content_hash": "bc26d13a3adca7a5919e439a88e7bcb9cf4ef1c9a6d53be9476954c30a354343", "created_at": "2026-03-28T05:10:40.354240185Z"}
{"id": "535766dc-1a6b-440e-8d85-f7e59e02bc8f", "source": "brain", "text": "Optical Properties of dendritic agate | Luster\n\nOptical Properties of dendritic agate | Luster\n\u00d7\ndendritic agate\n\u2612\nTop\nADD \u2295\nCompare\nGemstones\nGems for Taurus\nGems for Gemini\nGems for Leo\nOrganic\nGems for Aries\nGems for Cancer\nGems for Libra\nGems for Capricorn\n\u2315\n\u25bc\nOptical Properties of dendritic agate\ndendritic agate\nAdd \u2295\nSummary\nAstrology\nPhysical Properties\nOptical Properties\nBenefits\nAll\nOptical Properties\nLuster\n-\nPleochroism\n-\nDispersion\n0.01\nRank: 60 (Overall)\n0.005 1\n\ud83d\udc46\ud83c\udffb\nTransparency\nTranslucentWalter Schumann\nRefractive Index\n-9999\n1 3.25\n\ud83d\udc46\ud83c\udffb\nOptic Character\n-\nCrystal System\n-\nBirefringence\n-9999\n0 0.296\n\ud83d\udc46\ud83c\udffb\nClarity\nTranslucentWalter Schumann\ndendritic agate Luster\nOptical Properties of dendritic agate are its behavioral responses towards light. While few optical properties can be identified with naked eyes, other require special instruments by the gemologists to identify them. dendritic agate optical properties like luster, clarity, refractive index etc. are used to determine the non-destructive methods during gemstone identification and evaluation.\ndendritic agate luster is the quantity of light the crystal reflects when light is incident on it. dendritic agate which is commonly found in White, Colorless, Blue, Red, Green, Yellow, Violet color, is TranslucentWalter Schumann in nature.\nBlue Gemstones\nGrossular Garnet\nAndradite Garnet\nIndicolite\nOrbicular jasper\nPlasma\nBlue spinel\ndendritic agate Refractive Index\nOptical properties of a dendritic agate crystal are responsive to the small changes in composition and strain within its crystalline structure. Absolute diligence is therefore necessary during cutting and polishing of the gemstone. All such optical properties are majorly influenced by Physical Properties of dendritic agate.\nAs we are well aware, refractive index is the phenomenon which is related to bending of light through a medium (crystal). It is used in qualitative analysis of gemstones by gemologists Besides, few gemstones exhibit property of dual refractive indices. This dual nature is known as Birefringence. So if you are searching for prominent Blue Gemstones, dendritic agate gem is something not miss on, since it has been a favorite pick in the gem wearing community.\nCompare Blue Gemstones\nGrossular Garnet Vs Plasma\nGrossular Garnet Vs Blue spinel\nGrossular Garnet Vs Trapiche emerald\nTrapiche emerald\nAstrology | Physical ... | Optical P... | Benefits\nLemon quartz\nAstrology | Physical ... | Optical P... | Benefits\nRutilated topaz\nAstrology | Physical ... | Optical P... | Benefits\nAndradite Garnet Vs Grossular...\nAstrology | Physical ... | Optical P... | Benefits\nIndicolite Vs Grossular Garnet\nAstrology | Physical ... | Optical P... | Benefits\nOrbicular jasper Vs Grossular...\nAstrology | Physical ... | Optical P... | Benefits\nHome |\nAbout |\nContact |\nDisclaimer |\nTerms of Use |\nPrivacy Policy\n\u00a9 2015 - 2026 www.compareusvista.com\nDeveloped & Maintained by softUsvista Inc.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/535766dc-1a6b-440e-8d85-f7e59e02bc8f", "content_hash": "aa221d24ebfb81e95f5134962c821d5904679f101650046ec2207cbb1401f0df", "created_at": "2026-03-28T05:10:40.314424449Z"}
{"id": "f840330a-047b-4eb8-8051-b379b0e5b2ee", "source": "brain", "text": "Subjects: Cerebral Cortex -- pathology - Digital Collections - National Library of Medicine Search Results\n\nSubjects: Cerebral Cortex -- pathology - Digital Collections - National Library of Medicine Search Results\nSkip to search Skip to main content Skip to first result\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\nSearch\nSearch Constraints\nStart Over You searched for: Subjects Cerebral Cortex -- pathology \u2716 Remove constraint Subjects: Cerebral Cortex -- pathology\n1 - 4 of 4\nSort by title\nrelevance title\nNumber of results to display per page\n10 per page per page\n10 per page 20 per page 50 per page 100 per page\nSearch Results\n1. Cases illustrating cortical paralysis with loss of speech\nAuthor(s):\nGreenlees, T. Duncan (Thomas Duncan), 1858- author\nPublication:\n[Utica, N.Y.?] : [publisher not identified], [1887?]\nSubject(s):\nCerebral Cortex -- pathology\nParesis\nAphasia\n2. On arrested cerebral development with special reference to its cortical pathology\nAuthor(s):\nSachs, Bernard, 1858-1944\nPublication:\nNew York : [s.n.], 1887\nSubject(s):\nBrain -- abnormalities\nCerebral Cortex -- pathology\nInfant\n3. Some minor studies in nerve cell degeneration as presented by a case of localized cerebral atrophy\nAuthor(s):\nProut, Thomas P., author\nPublication:\n[Baltimore?] : [publisher not identified], [1895?]\nSubject(s):\nCerebral Cortex -- pathology\nAtrophy\nNerve Degeneration\n4. Studies on the lesions produced by the action of certain poisons on the nerve cell. Part II, Experimental lesions produced by the action of dog's serum on the cortical nerve-cell of the rabbit's brain : preliminary paper\nAuthor(s):\nBerkley, Henry J. (Henry Johns), 1860-1940 author\nPublication:\nPhiladelphia : Lea Brothers & Co., [1895?]\nSubject(s):\nNeurons -- pathology\nCerebral Cortex -- pathology\nSerum\nRefine by:\nShow facets Hide facets\nFormats\nText4\nCollections\nMedicine in the Americas, 1610-19204\nSubjects\nCerebral Cortex -- pathology\u2716[remove]4\nAphasia1\nAtrophy1\nBrain -- abnormalities1\nInfant1\nmore Subjects \u00bb\nAuthors\nBerkley, Henry J. (Henry Johns), 1860-1940 author1\nGreenlees, T. Duncan (Thomas Duncan), 1858- author1\nProut, Thomas P., author1\nSachs, Bernard, 1858-19441\nTitles\nCases illustrating cortical paralysis with loss of speech1\nOn arrested cerebral development with special reference to its cortical pathology1\nSome minor studies in nerve cell degeneration as presented by a case of localized cerebral atrophy1\nStudies on the lesions produced by the action of certain poisons on the nerve cell. Part II, Experimental lesions produced by the action of dog's serum on the cortical nerve-cell of the rabbit's brain : preliminary paper1\nLanguages\nEnglish4\nGenre\nCase Reports3\nCopyright\nPublic domain4\nDates by Range\n1850-18994\nPublication Year\nBegin\nEnd\n1000 to 10990\n1100 to 11990\n1200 to 12990\n1300 to 13990\n1400 to 14990\n1500 to 15990\n1600 to 16990\n1700 to 17990\n1800 to 18994\n1900 to 19990\n2000 to 20260\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/f840330a-047b-4eb8-8051-b379b0e5b2ee", "content_hash": "7e92d349673fd62ab53d12b4bc33b1450b6257a85639a8cb6cf37a6a35735ca6", "created_at": "2026-03-28T05:10:40.309023903Z"}
{"id": "fbbc060b-af22-444e-9b33-f9fcd2fd224f", "source": "brain", "text": "\u0425\u041e\u0411\u041b: \u043a\u0430\u043a\u0438\u0435 \u043c\u0435\u0442\u043e\u0434\u044b \u043b\u0435\u0447\u0435\u043d\u0438\u044f \u044d\u0444\u0444\u0435\u043a\u0442\u0438\u0432\u043d\u044b?- Patient Information | BMJ Best Practice\n\n\u0425\u041e\u0411\u041b: \u043a\u0430\u043a\u0438\u0435 \u043c\u0435\u0442\u043e\u0434\u044b \u043b\u0435\u0447\u0435\u043d\u0438\u044f \u044d\u0444\u0444\u0435\u043a\u0442\u0438\u0432\u043d\u044b?- Patient Information | BMJ Best Practice\nSkip to main contentSkip to search\nEnglish (US)EnglishPortugu\u00eas\nLog in\nPersonal account\nAccess through your institution(Open Athens)\nSubscribe\nAccess through your institution\nLog in\nEnglish (US)EnglishPortugu\u00eas\nHome\nSearch\n\ue8b6Search\nHome\nAbout us\nOverviewWhat is BMJ Best Practice?Our history\nKey featuresClinical tools Local guidanceEarn CME/CPD pointsAccess anywhereOur appIntegration\nOur Evidence approachTrusted contentUpdating process\nWho we help\nBest Practice for...CliniciansHospitalsMedical librariansMedical schoolsMedical studentsNursesPharmacistsPrimary careParamedicsTelehealth\nHow we help\nImpact and effectivenessEvidence of effectiveness Global impactCustomer stories\nBrowse clinical content\nRecent updates\nSpecialties\nTry a free topic\nPatient information\nVideos\nCalculators\nWhat\u2019s new\nClinical updates\nNews\nPodcast\nAccess\nLog in via...Personal subscription or user profileAccess through your institution\nAccess code\nSubscribe\nFree trial\nHow do I get access?\nDownload the app\nHelp\nFAQs\nHow do I get access?\nContact us\n\ue317Patient information\nPatient information from BMJ\nPrintDownload PDF\n\u0425\u041e\u0411\u041b: \u043a\u0430\u043a\u0438\u0435 \u043c\u0435\u0442\u043e\u0434\u044b \u043b\u0435\u0447\u0435\u043d\u0438\u044f \u044d\u0444\u0444\u0435\u043a\u0442\u0438\u0432\u043d\u044b?\nLast published:Dec 06, 2021\nCOPD stands for chronic obstructive pulmonary disease. It means that lung damage is stopping your lungs working as well as they used to. There is no cure but there are treatments that can help stop it getting worse.\nYou can use our information to talk to your doctor and decide which treatments are right for you.\nWhat treatments work?\nIf you have COPD the airways in your lungs have been damaged over many years. This damage is usually caused by smoking. But other things can cause COPD, including:\nbreathing in other poisonous chemicals (possibly through long exposure to severe air pollution), and\nsome inherited genetic conditions.\nThe aims of treatment for COPD are:\nto prevent and control symptoms\nto reduce the number of exacerbations (this is when your symptoms suddenly get worse) you have and to make them less severe.\nto help your lungs to work better, and\nto help you live a longer and healthier life.\nYour treatment should include regular appointments with your doctor to check on your progress. Your doctor should make sure that you understand:\nwhat COPD is, and\nhow to recognise an exacerbation.\nStopping smoking\nThese days, the main cause of COPD is smoking. Stopping smoking can:\nslow down the damage COPD does to your lungs\nreduce your chance of cancer and heart problems related to COPD\nhelp you live longer with a better quality of life.\nOf course, stopping smoking is not easy, especially if you have smoked for many years. So your doctor may recommend a stop-smoking programme to help you stop. This may include counselling, group meetings, and medication.\nFor more information on ways to help you stop smoking, see our leaflet Stopping smoking.\nStaying healthy\nYour doctor might discuss self-management with you. This doesn't mean that you have to take care of yourself, without medical care. It means that you are helped to learn about COPD so that you can help control it.\nPeople who learn to self-manage their COPD tend to need less hospital treatment.\nSelf-management plans that you discuss with your doctor should include learning about:\nmanaging breathlessness\nmanaging stress\nconserving energy\navoiding things that make your symptoms worse\nthe right types of exercise for people with COPD (and specifically for you), and\ncontact information to use if you have an exacerbation.\nSome people are able to take part in a lung-care programme. They're usually called pulmonary rehabilitation programmes).\nThese programmes are usually organised in hospitals. You'll learn about how your lungs work and how to do exercises that make them stronger. You'll need to keep doing these exercises at home, after your programme finishes.\nYou'll also learn about your medicines and the best way to take them. Ask your doctor if there\u2019s a local programme near you.\nTaking part in a programme can:\nreduce your chance of needing hospital treatment\nreduce the depression and anxiety that sometimes go along with COPD\nreduce fatigue\nincrease how much you are able to exercise\nhelp improve your quality of life: for example, by helping you feel more in control of your life and your illness.\nRegular exercise can help you stay healthy. Even gentle exercise, such as walking, can help you get fitter and do more of the things you enjoy. Everyone with COPD should try to do as much exercise as they can to keep their lungs as fit as possible.\nIt's also important to get your flu and pneumonia jabs (vaccinations). If you have COPD, getting flu or pneumonia can be very serious. Talk to your doctor and make sure you get protected. You need a new flu jab every year.\nMedicines you breathe in\nMany types of medicine are used to treat people with COPD, depending on what works best for each person. Here, we look at the main ones.\nThe first treatment you get for COPD will probably be an inhaler, just as you would use if you had asthma. Breathing in medicine through an inhaler helps to open up the airways in your lungs and make breathing easier.\nThere are several kinds of inhaler, so if you find yours hard to use, talk to your doctor. He or she will be able to suggest a different type.\nSeveral types of medication can help relieve the symptoms of COPD when inhaled.\nBronchodilators are drugs that help to open up the airwaves by relaxing the muscles around the lungs. There are different kinds: some work quickly to give you fast relief from symptoms and others have a more long-term effect.\nYou may hear your doctor refer to these as short-acting and long-acting drugs. Bronchodilators that you might be prescribed include:\ndrugs called beta agonists. These drugs help relax the muscles in the lungs. There are short-acting and long-acting versions.\nanticholinergic drugs. These help relax the muscles in the lungs in a slightly different way from bronchodilators. They also come in short- and long-acting versions.\nOther drugs are available if the main ones don't work well enough, but they are less commonly used.\nBronchodilators can cause side effects in some people. For example, bronchodilators called beta-2 agonists may make your hands tremble, or they may make your heart beat faster, especially if you already have a heart problem.\nTaking a beta-2 agonist for a long time slightly raises your chance of heart problems, so your doctor should monitor you regularly.\nIf you've already tried short-acting and long-acting inhalers and you still get symptoms, your doctor may suggest you use a steroid inhaler (the full name is corticosteroid). You use this along with a bronchodilator. You may be able to use a single inhaler that contains both drugs.\nCorticosteroids help open your airways by reducing inflammation in the lungs. They can help reduce exacerbations and may even help you live longer.\nBut they are only recommended for people with advanced COPD who have frequent exacerbations. This is because corticosteroids can cause serious side effects.\nThe most common side effect is a fungal infection (thrush) in the mouth or throat. It can usually be avoided by gargling with water after each puff. Other possible side effects include weakened bones and easy bruising, but these are more common with steroid tablets than with the inhaled versions.\nCorticosteroids can also increase your chances of getting pneumonia. So your doctor will be cautious about prescribing them if he or she thinks you are at high risk of pneumonia.\nDoctors use what's called a 'stepwise' approach for COPD medications. This means that you start on the lowest possible dose of medicine that's suitable for the severity of your symptoms. Your doctor can then increase or reduce the dose or number of drugs you use, depending on what helps you most.\nFor your first 'step' you'll probably use a fast-acting inhaler. You can use this for quick relief when you get", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/fbbc060b-af22-444e-9b33-f9fcd2fd224f", "content_hash": "c672b26d8550f2af04119302b847034879ebaa76b316848f3499109c7ad70f23", "created_at": "2026-03-28T05:10:40.166260151Z"}
{"id": "2f6463b4-e37a-4437-bd7f-f5f316a8147d", "source": "brain", "text": "Asiacell Products - Mobiles & Tablets - iTunes - Black Titanium\n\nAsiacell Products - Mobiles & Tablets - iTunes - Black Titanium\nThe store will not work correctly in the case when cookies are disabled.\nJavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.\n\u0639\u0631\u0628\u0649\n\u06a9\u0648\u0631\u062f\u06cc\nBack To Asiacell\nAuto Login\nAbout Asiacell Support\nPartner Registration Form\nCompare Products\nFAQ\nReturn & Exchange Policy\nToggle Nav\nMenu\nMy Cart\nAuto Login\nLanguage\n\u0639\u0631\u0628\u0649\n\u06a9\u0648\u0631\u062f\u06cc\nPartner Registration Form\nCompare Products\nFAQ\nReturn & Exchange Policy\nAsiamall\nMobile\nDigital Vouchers\nComputer\nGaming\nElectronic\nAccessories\nHome Appliances\nAsiacell Products\nAccount\nLOG IN\nMy Cart\nSearch\nSearch\nSearch\nHome\nAsiamall\nAsiacell Products\nAsiacell Products\nAsiacell Products\nSpecial Offer\nMobiles & Tablets\nDigital Vouchers\nAccessories\nAir & Travel\nSmartwatches\nSmart Security\nLaptops & PC\nGaming\nHome Appliances\nWatches\nAll Phones\nEufy\nXiaomi\nHonor\nShop By\nClear All\nBuy Electronics, devices & More | Asia Mall by Asiacell \u2013 Iraq's Online Shopping\nAccess to Partner Services\nYou're now being re-directed to access services provided by our trusted partner. Please note that all service delivery, support, and terms are managed by the partner. We encourage you to review their terms and conditions. Click Continue to proceed.\nWe can't find products matching the selection. Please click here to reset filter\nFilters\nAll Devices\nNow Shopping by\nCategory Mobiles & Tablets Remove This Item\nVoucher Sub-category iTunes Remove This Item\nColor Black Titanium Remove This Item\nClear All\nShopping Options\nQuick Link\nQuick pay/Recharge\nPartner Registration Form\nCustomer Service\nHelp\nMy Account\nOrder History\nAddresses\nShopping Cart\nMy Profile\nTrack your order\nCorporate Info\nTerms & Conditions\nDownload the Asiacell App\nAbout Asiacell\nFAQ\nPolicy & Warranty\nDownload the Asiacell App\n\u00a9 Asiacell 2023 to 2025. All rights reserved.\nConnect with us on", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/2f6463b4-e37a-4437-bd7f-f5f316a8147d", "content_hash": "21d75f67e31b6cece8e471ae46326375c09e76f632df953f48c82d1be04d9897", "created_at": "2026-03-28T05:10:40.075344132Z"}
{"id": "8c17efee-ac86-4ad9-98f1-82cba3b2437a", "source": "brain", "text": "Kyanite and Hessonite Garnet Physical Properties\n\nKyanite and Hessonite Garnet Physical Properties\n\u00d7\nKyanite\n\u2612\nHessonite Garnet\n\u2612\nTop\nADD \u2295\nCompare\nGemstones\nGems for Taurus\nGems for Gemini\nGems for Leo\nOrganic\nGems for Aries\nGems for Cancer\nGems for Libra\nGems for Capricorn\n\u2315\n\u25bc\nX\nKyanite\nX\nHessonite Garnet\nKyanite and Hessonite Garnet Physical Properties\nKyanite\nHessonite Garnet\nAdd \u2295\nSummary\nAstrology\nPhysical Properties\nOptical Properties\nBenefits\nAll\nPhysical Properties\nTenacity\nBrittle\n-\nSolubility\n-\n-\nDurability\n-\n-\nSpecific Gravity\n3.53-3.65-9999\n1 7.18\n\ud83d\udc46\ud83c\udffb\nFracture\nSplintery\n-\nCleavage\n[100] perfect [010] imperfect with 79\u00b0 angle between\nNone\nMohs Hardness\n4-7-9999\n2 10\n\ud83d\udc46\ud83c\udffb\nChemical Composition\nAl2SiO5\nCa3Al2(SiO4)3\nKyanite and Hessonite Garnet Chemical Formula\nWhile comparing Kyanite and Hessonite Garnet physical properties, the important data you should know is its chemical composition. Since chemical formula defines the molecular structure of the crystal, most of the physical properties like color, tenacity, solubility are governed by Kyanite and Hessonite Garnet chemical formula.\nChemical formula of Kyanite- Al2SiO5\nChemical formula of Hessonite Garnet- Ca3Al2(SiO4)3\nCompare Gems for Aries \u00bb More\nKyanite Vs Jade\nKyanite Vs Hematite\nKyanite Vs Garnet\n\u00bb More Compare Gems for Aries\nKyanite and Hessonite Garnet Specific Gravity\nAnother important criteria for qualitative analysis of gemstones is Kyanite and Hessonite Garnet Specific gravity. Specific gravity is the relative density of a gemstone compared with respect to density of water. Gemologists use Kyanite and Hessonite Garnet Optical Properties during the identification of gemstone. Specific gravity of Kyanite is whereas that of Hessonite Garnet is .\nGems for Aries \u00bb More\nApache Tear\nBixbite\nBloodstone\nJasper\nJade\nHematite\n\u00bb More Gems for Aries\nGems for Aries \u00bb More\nGarnet\nAstrology | Physical ... | Optical P... | Benefits\nEmerald\nAstrology | Physical ... | Optical P... | Benefits\nAventurine\nAstrology | Physical ... | Optical P... | Benefits\nCompare Gems for Aries \u00bb More\nHessonite Garnet Vs Bixbite\nAstrology | Physical ... | Optical P... | Benefits\nHessonite Garnet Vs Bloodstone\nAstrology | Physical ... | Optical P... | Benefits\nHessonite Garnet Vs Jasper\nAstrology | Physical ... | Optical P... | Benefits\nHome |\nAbout |\nContact |\nDisclaimer |\nTerms of Use |\nPrivacy Policy\n\u00a9 2015 - 2026 www.compareusvista.com\nDeveloped & Maintained by softUsvista Inc.", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/8c17efee-ac86-4ad9-98f1-82cba3b2437a", "content_hash": "203e699d30d7c16238603191a4a1352463e19da576ab13a1ec98398d25af4dc8", "created_at": "2026-03-28T05:10:40.051009326Z"}
{"id": "2bd3a17b-88d8-4f17-92f1-2cb9884a2b40", "source": "brain", "text": "Jewellery for your feet - Silver Ethnic Anklets | Stylish By Nature By Shalini Chopra | India Fashion Style Blog | Beauty | Travel | Food | Bollywood\n\nJewellery for your feet - Silver Ethnic Anklets | Stylish By Nature By Shalini Chopra | India Fashion Style Blog | Beauty | Travel | Food | Bollywood\nHome\nAbout\nContact\nAwards\nHome\nFashion\nFood N Wine\nTravel\nBeauty\nLifestyle\nBollywood\nEvents\nTechnology\nMy Lookbook\nLookbook 19-20\nLookbook 2018\nLookbook 2017\nLookbook 2016\nLookbook 2015\nLookbook 2014\nLookbook 2013\nShop My Closet\nSBN Club\n#Trend\nLoading...\nHome / 2013 maxi dresses / Accessories trend 2013 / best fashion blog india / casual street style for women in india / contest or sweepstakes / online shopping site / Jewellery for your feet - Silver Ethnic Anklets\nJewellery for your feet - Silver Ethnic Anklets\n2013 maxi dresses , Accessories trend 2013 , best fashion blog india , casual street style for women in india , contest or sweepstakes , online shopping site\nHi Everyone,\nThe essential jewellery for your feet: Silver Anklets\nAnklets have an extensive and huge demand in the world. With passage of time, women from many civilizations used ankle bracelets to form a sexy look, show their affluence, indicate marital status, draw a suitor, and draw the attention to their pretty, well groomed, feet. Certainly, the use of anklets may have been the precursor to the contemporary pedicure, painted toenails, and high heels.\nFrom the very old Sumerians in Mesopotamia over 4000 years ago came the initial proof of the use of ankle bracelets.\nIn Ancient Egypt, both the wealthy and deprived wore anklets. The wealthy wore anklets ornamented with precious stones and made from high-priced metals, while the poor used them to exhibit charms and amulets. In the earlier period, all through the Middle East, the anklets were frequently associated by a stretch of chain to make a shorter, feminine step.\nThe ankle bracelet originally became admired in the United States in the 1950's, and saw a resurgence in esteem in the 1970's as women began wearing bracelets with their name or initials on them.\nIn adding up to their use in the twenty-first century amid the fashionable, ankle bracelets have also taken on a useful turn for some. Police and the judicial system have turned to anklets in order to check the activities of the criminal, the rehabilitated, and those in need of rehabilitation. Modern ankle bracelets can offer a GPS location of their wearer to the judicial system or a parole officer, permitting better monitoring of their activities.\nBut the richest account of anklets may have developed in India. Anklets were an imperative tradition used to sign marital status and still are an essential part of ceremonial wedding garments.\nBut marriage and relationship standing weren't the only things which anklets were used for in history. Indian women also attached anklets with bells during dances to produce a striking jingle to go with their movements. The use of ankle bracelets as an ornament to a dance costume was also seen among belly dancers in the Middle East, who generally wore elaborate jewellery along with their outfits.\nAnklets have been in use since ages and the delicate attractiveness of a woman's anklets get multiplied when decorated with a pair of exclusively designed anklets, ideal piece of art. They can effortlessly gel well with both recognized and informal wears and has become a quite fashion rage amongst all age groups, particularly the teenage group.\nConventionally in use, anklets have even taken up the contemporary fashion world with a storm and they are being worn by both adolescent and unmarried women in India.\nThe anklets come with adoring accompaniments, intricate carvings and other fine artistry effortlessly done on metal. Previously the anklets were made of silver or brass but their attractiveness has made the manufacturers try out other metals and experiment with conventional and modern designs.\nSilver anklets with semi precious stones like garnets, topaz, Amethyst, aqua marine and others are a fashionable way of adorning your legs and adding colour to your outfit in the summers.\nTill next time....Keep it STYLISH By Nature !!\nJoin Me on\nFACEBOOK | TWITTER | BLOGLOVIN\nShare on Facebook Share on Twitter Share on Google Plus\nRELATED POSTS >>>\nRELATED POSTS\nBlogger Comment\nFacebook Comment\nNewer Post Older Post Home\nFeatured Video\nIIFA New York - Vlog\nPopular Posts\nStyling Tips for Cocktail Party Dresses\nHi Everyone, Backless Maxi Cocktail Dress - 6ks Peep-Toe Heels - OASAP (available in 2 colors) Sapphire and Spikes Bracelet - You...\nFeatured Blog of the Week - Look10\nHi Everyone, Thrilled to share that 'Stylish By Nature' is featured as the 'Blog of the Week' at Look10. ...\nCOACH STORE IN UB City BANGALORE\nHi Everyone, COACH OPENS NEW STORE IN UB City, BANGALORE Coach, a global design house of modern luxury leather goods, apparel and...\nFashion Trend Pastels and Neons 2013\nHi Everyone,\nChristmas New Year 2012 Sequin heels dress party\nHi Everyone,\nReady for the SPRING !!\nHello Everyone, Spring/Summer 2012 is in wings and all we fashionistas are already shopping to ready our wardrobe for the upcoming seaso...\nFashion Trend: Jumpsuits this Summer\nHi Everyone,\nTwitter\nTweets by <USER_17>\n\u00a9 StylishByNature 2011-2014. Powered by Blogger.\nCopyright \u00a9 2014 Stylish By Nature By Shalini Chopra | India Fashion Style Blog | Beauty | Travel | Food | Bollywood", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/2bd3a17b-88d8-4f17-92f1-2cb9884a2b40", "content_hash": "c711144bc21673504d2afaee058b187eb82539776f2895545d18bc6377742163", "created_at": "2026-03-28T05:10:40.045132669Z"}
{"id": "421e9906-6a3d-4e02-b8d9-334be94b0b51", "source": "brain", "text": "Lisdexamfetamine - AdisInsight\n\nLisdexamfetamine - AdisInsight\nEither you have JavaScript disabled or your browser does not support Javascript . To work properly, this page requires JavaScript to be enabled.\nHow to enable JavaScript in your browser?\nSkip to main content\nWelcome to AdisInsight\nRegister your email address to show your organization how much you value your AdisInsight subscription.\nWith your consent we\u2019ll provide this information to your organization\u2019s account administrator to aid in the renewal decision and we will send you important updates about AdisInsight.\nPlease refer to our privacy policy for information on how we protect your personal information.\nEnter e-mail address here Enter valid e-mail address\nYou will receive an email to validate your email address. You will see this pop-up again if your browser cookies are cleared on your computer.\nProvide Consent\nDecline Consent\nWelcome to AdisInsight\nClose\nVerification link has been sent to the e-mail address entered below. Click on that link to proceed.\nChange email ID\nResend link\nX\nAsk the expert\nDo you need help? Please contact one of our AdisInsight experts. We aim to get back to you with personalized answer within 24 hours.\nFull name *\nEmail address *\nQuestion / Comment *\nSubmit\nThank you\nOur team would reach out to you shortly in response for your query.\nReturn to homepage\nLogin\nUsername/Password\nInstitution access\nInsight Hub New\nAPIs\nContact Us\nHelp\nRequest demo\nInsight Hub New\nAPIs\nContact Us\nHelp\nLogin\nUsername/Password Institution access\nRequest demo\nSearch filter dropdown Select a filter\nDrug Name\nIndication\nMechanism\nDrug Class\nAdverse Event\nAll Text\nSearch Cancel Search\nDrug Safety : ADR Category 1\nLisdexamfetamine\nParalytic ileus: case report\nSerious\nAn event is determined to be serious (based on the ICH definition) when the patient outcome is:\ndeath\nlife-threatening\nhospitalisation\ndisability\ncongenital anomaly\nother medically important event\nRelease Date: 22 Apr 2025 Update Date: 22 Apr 2025\nPrice :\n$20 *\nBuy Profile\nNote:\nAdis is an information provider.\nFinal gross price and currency may vary according to local VAT and billing address.\nYour purchase entitles you to full access to the information contained in our drug safety profile at the time of purchase.\nA link to download a PDF version of the drug safety profile will be included in your email receipt.\nYou need to be a logged in or subscribed to view this content\nRequest demo (opens in a new window)\nIf your organization or you do not have a subscription, try one of the following:\nContacting your organization\u2019s admin about adding this content to your AdisInsight subscription\nBuying a PDF version of any individual profile\nRequest a free trial (opens in a new window)\nIf your organization has a subscription, there are several access options, even while working remotely:\nWorking within your organization\u2019s network\nLogin with username/password or try to access via your institution\nPersisted access using your organization\u2019s identifier stored in your user browser for 90 days\nFor assistance, contact us at <EMAIL_7>\nScientifically curated records\nAbout our content\nDrugs\nTrials\nSafety Reports\nDeals\nPatents\nInsight Hub\nAPIs\nDashboards\nOther sites\nSpringer.com\nSpringerLink\nSpringer for R&D\nSpringerProtocols\nSpringerMaterials\nSpringerReference\nHelp & Contacts\nContact us\nHelp\nDownloads\nBizInt setup(windows only)\nLegal\nPrivacy policy, disclaimer, general terms & conditions\nTerms of Use\nYour US state privacy rights\nCookie policy\nYour privacy choices/Manage cookies\nAdis International Ltd. Part of Springer Science+Business Media\n\u00a9 Springer Nature Switzerland AG\n\u00a9 2026 Springer Nature Switzerland AG, Part of Springer Nature\nBack to top", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/421e9906-6a3d-4e02-b8d9-334be94b0b51", "content_hash": "ac2f2aa87e390a2f9aaa1a5e6abbccaa90b6d9bd48e25adc826e4c474318a37b", "created_at": "2026-03-28T05:10:39.953640549Z"}
{"id": "8c0d00ba-ec10-4205-bb8b-7fa6176878ec", "source": "brain", "text": "ten_crop \u2014 Torchvision 0.25 documentation\n\nten_crop \u2014 Torchvision 0.25 documentation\nLearn\nGet Started\nRun PyTorch locally or get started quickly with one of the supported cloud platforms\nTutorials\nWhats new in PyTorch tutorials\nLearn the Basics\nFamiliarize yourself with PyTorch concepts and modules\nPyTorch Recipes\nBite-size, ready-to-deploy PyTorch code examples\nIntro to PyTorch - YouTube Series\nMaster PyTorch basics with our engaging YouTube tutorial series\nEcosystem\nTools\nLearn about the tools and frameworks in the PyTorch Ecosystem\nCommunity\nJoin the PyTorch developer community to contribute, learn, and get your questions answered\nForums\nA place to discuss PyTorch code, issues, install, research\nDeveloper Resources\nFind resources and get questions answered\nContributor Awards - 2024\nAward winners announced at this year's PyTorch Conference\nEdge\nAbout PyTorch Edge\nBuild innovative and privacy-aware AI experiences for edge devices\nExecuTorch\nEnd-to-end solution for enabling on-device inference capabilities across mobile and edge devices\nExecuTorch Docs\nDocs\nPyTorch\nExplore the documentation for comprehensive guidance on how to use PyTorch\nPyTorch Domains\nRead the PyTorch Domains documentation to learn more about domain-specific libraries\nBlogs & News\nPyTorch Blog\nCatch up on the latest technical news and happenings\nCommunity Blog\nStories from the PyTorch ecosystem\nVideos\nLearn about the latest PyTorch tutorials, new, and more\nCommunity Stories\nLearn how our community solves real, everyday machine learning problems with PyTorch\nEvents\nFind events, webinars, and podcasts\nNewsletter\nStay up-to-date with the latest updates\nAbout\nPyTorch Foundation\nLearn more about the PyTorch Foundation\nGoverning Board Cloud Credit Program Technical Advisory Council Staff Contact Us\nBecome a Member\nten_crop\u00b6\ntorchvision.transforms.functional.ten_crop(img: Tensor, size: list[int], vertical_flip: bool = False) \u2192 tuple[torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor, torch.Tensor][source]\u00b6\nGenerate ten cropped images from the given image. Crop the given image into four corners and the central crop plus the flipped version of these (horizontal flipping is used by default). If the image is torch Tensor, it is expected to have [\u2026, H, W] shape, where \u2026 means an arbitrary number of leading dimensions\nNote\nThis transform returns a tuple of images and there may be a mismatch in the number of inputs and targets your Dataset returns.\nParameters:\nimg (PIL Image or Tensor) \u2013 Image to be cropped.\nsize (sequence or int) \u2013 Desired output size of the crop. If size is an int instead of sequence like (h, w), a square crop (size, size) is made. If provided a sequence of length 1, it will be interpreted as (size[0], size[0]).\nvertical_flip (bool) \u2013 Use vertical flipping instead of horizontal\nReturns:\ntuple (tl, tr, bl, br, center, tl_flip, tr_flip, bl_flip, br_flip, center_flip) Corresponding top left, top right, bottom left, bottom right and center crop and same for the flipped image.\nReturn type:\ntuple\nNext Previous\n\u00a9 Copyright 2017-present, Torch Contributors.\nBuilt with Sphinx using a theme provided by Read the Docs.\nten_crop\nDocs\nAccess comprehensive developer documentation for PyTorch\nView Docs\nTutorials\nGet in-depth tutorials for beginners and advanced developers\nView Tutorials\nResources\nFind development resources and get your questions answered\nView Resources\nPyTorch\nGet Started\nFeatures\nEcosystem\nBlog\nContributing\nResources\nTutorials\nDocs\nDiscuss\nGithub Issues\nBrand Guidelines\nStay up to date\nFacebook\nTwitter\nYouTube\nLinkedIn\nPyTorch Podcasts\nSpotify\nApple\nGoogle\nAmazon\nTerms\n|\nPrivacy\n\u00a9 Copyright The Linux Foundation. The PyTorch Foundation is a project of The Linux Foundation. For web site terms of use, trademark policy and other policies applicable to The PyTorch Foundation please see www.linuxfoundation.org/policies/. The PyTorch Foundation supports the PyTorch open source project, which has been established as PyTorch Project a Series of LF Projects, LLC. For policies applicable to the PyTorch Project a Series of LF Projects, LLC, please see www.lfprojects.org/policies/.\nTo analyze traffic and optimize your experience, we serve cookies on this site. By clicking or navigating, you agree to allow our usage of cookies. As the current maintainers of this site, Facebook\u2019s Cookies Policy applies. Learn more, including about available controls: Cookies Policy.\nLearn\nGet Started\nTutorials\nLearn the Basics\nPyTorch Recipes\nIntroduction to PyTorch - YouTube Series\nEcosystem\nTools\nCommunity\nForums\nDeveloper Resources\nContributor Awards - 2024\nEdge\nAbout PyTorch Edge\nExecuTorch\nExecuTorch Documentation\nDocs\nPyTorch\nPyTorch Domains\nBlog & News\nPyTorch Blog\nCommunity Blog\nVideos\nCommunity Stories\nEvents\nNewsletter\nAbout\nPyTorch Foundation\nGoverning Board\nCloud Credit Program\nTechnical Advisory Council\nStaff\nContact Us", "license": "apache-2.0", "quality_score": 0.75, "provenance": "pi.ruv.io/memory/8c0d00ba-ec10-4205-bb8b-7fa6176878ec", "content_hash": "a805ffcd1e231797e2245fd9b9fc60ce50bf50848dec7c867c7666b1ae3a6e81", "created_at": "2026-03-28T05:10:39.925423436Z"}
{"id": "33e65884-ebe1-43e7-99f4-39c0352d3ec1", "source": "brain", "text": "AccessGUDID - Origin\n\nAccessGUDID - Origin\nSkip to Main Content\nNational Library of Medicine NLM\nTools and Resources\nFDA UDI Home\nFDA Medical Devices Home\nReport a Device Problem (MedWatch)\nDevice Recalls\nDevice Safety Communications\nHome\nAbout\nNews\nDownload\nAPI\nHelp\nCustomer Support & FAQ\nFDA Tools and Resources\nFDA UDI Home\nFDA Medical Devices Home\nReport a Device Problem (MedWatch)\nDevice Recalls\nDevice Safety Communications\nGUDID\nMENU\nHome\nAbout\nNews\nAPI\nDownload\nHelp\nFDA TOOLS & RESOURCES\nFDA UDI Home\nFDA Medical Devices Home\nReport a Device Problem (MedWatch)\nDevice Recalls\nDevice Safety Communications\nAdvanced Search\nSearch Help\nHome\nAbout\nNews\nAPI\nDownload\nHelp\nView More\nHome\nAbout\nNews\nAPI\nDownload\nHelp\nSEARCH RESULTS FOR: Origin(1 result)\nExport results\nSearch Summary\nXML\nCSV\nXLS\nJSON\nFull Record\nDelimited .TXT Files\nFilters\nSort By\nRelevance\nCompany Name (A-Z)\nCompany Name (Z-A)\nBrand Name (A-Z)\nBrand Name (Z-A)\n10\nResults Per Page\n10\nResults/Pg\n10\n20\n30\n40\n50\n<\nPage\n1 >\n1\nCompany Name\nSynapse Biomedical, Inc. (1)\nBrand Name\nNeuRx DPS\u2122 Patient Kit, 1 EPG (1)\nGMDN Term Name\nIntramuscular diaphragm/phrenic nerve electrical stimulation system (1)\nGMDN Term Status\nActive (1)\nFDA Product Code Name\nDiaphragmatic/Phrenic Nerve Laparoscopically-Implanted Stimulator (1)\nFDA Product Code\nOIR (1)\nDevice Packaged As Sterile\nNo (1)\nSterilization Prior To Use\nNo (1)\nIssuing Agency\nGS1 (1)\nDevice Class\nClass III (1)\nImplantable\nYes (1)\nShow Filters\nNeuRx DPS\u2122 Patient Kit, 1 EPG - 00852184003052\nNo Description\nCompany Name: Synapse Biomedical, Inc.\nVersion or Model: 20-0046\nCommercial Distribution Status: In Commercial Distribution\nDevice IDs:\n00852184003052 ( Primary )\nCatalog Number:\nGMDN Terms:\nIntramuscular diaphragm/phrenic nerve electrical stimulation system\n< 1 >\nMENU\nHome\nAbout\nNews\nAPI\nDownload\nHelp\nFDA TOOLS & RESOURCES\nFDA UDI Home\nFDA Medical Devices Home\nReport a Device Problem (MedWatch)\nDevice Recalls\nDevice Safety Communications\nCustomer Support & FAQs\nAdvanced Search\nRSS\nCopyright\nPrivacy\nTerms of Use\nWeb Accessibility\nHHS Vulnerability Disclosure\nNational Institutes of Health\nNational Library of Medicine\nHealth & Human Services", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/33e65884-ebe1-43e7-99f4-39c0352d3ec1", "content_hash": "fcbbbd02426ba8c8c9710461b69fa9f320defa761a7ac46d21428666795377d1", "created_at": "2026-03-28T05:10:39.856998575Z"}
{"id": "dfcdbc18-ee53-488a-acba-08962a54e4f3", "source": "brain", "text": "Subjects: Hepatitis C - Digital Collections - National Library of Medicine Search Results\n\nSubjects: Hepatitis C - Digital Collections - National Library of Medicine Search Results\nSkip to search Skip to main content Skip to first result\nAn official website of the United States government. Here\u2019s how you know\nOfficial websites use .gov\nA .gov website belongs to an official government organization in the United States.\nSecure .gov websites use HTTPS\nA lock ( Lock\nA locked padlock ) or https:// means you\u2019ve safely connected to the .gov website. Share sensitive information only on official, secure websites.\nsearch for\nSearch\nAbout\nHelp\nWeb Service\nSearch\nSearch Constraints\nStart Over You searched for: Subjects Hepatitis C \u2716 Remove constraint Subjects: Hepatitis C\n1 - 2 of 2\nSort by relevance\nrelevance title\nNumber of results to display per page\n10 per page per page\n10 per page 20 per page 50 per page 100 per page\nSearch Results\n1. Cancer clinical trial eligibility criteria: patients with HIV, hepatitis B Virus, or hepatitis C Virus Infections\nPublication:\n[Silver Spring, MD] : United States Food and Drug Administration, Oncology Center of Excellence, July 2020\nSubject(s):\nClinical Trials as Topic\nHepatitis B\nHepatitis C\nHIV\nNeoplasms\nUnited States\nUnited States. Department of Health and Human Services\nUnited States. Food and Drug Administration\n2. Emerging infectious diseases\nAuthor(s):\nAvery, Eric.\nPublication:\n[2000]\nSubject(s):\nCommunicable Diseases\nHepatitis C\nHIV\nHospitals\nPatients\nPhysicians\nTuberculosis\nRefine by:\nShow facets Hide facets\nFormats\nStill image1\nText1\nCollections\nHealth Policy and Services Research1\nImages from the History of Medicine (IHM)1\nSubjects\nHIV2\nHepatitis C\u2716[remove]2\nClinical Trials as Topic1\nCommunicable Diseases1\nHepatitis B1\nmore Subjects \u00bb\nAuthors\nAvery, Eric.1\nTitles\nCancer clinical trial eligibility criteria: patients with HIV, hepatitis B Virus, or hepatitis C Virus Infections1\nEmerging infectious diseases1\nLanguages\nEnglish2\nGenre\nPictorial Work1\nTechnical Report1\nCopyright\nCopyright may apply1\nPublic domain1\nDates by Range\n2000 and later2\nPublication Year\nBegin\nEnd\n1000 to 10990\n1100 to 11990\n1200 to 12990\n1300 to 13990\n1400 to 14990\n1500 to 15990\n1600 to 16990\n1700 to 17990\n1800 to 18990\n1900 to 19990\n2000 to 20262\nConnect with NLM\nNational Library of Medicine\n8600 Rockville Pike\nBethesda, MD 20894\nWeb Policies\nFOIA\nHHS Vulnerability Disclosure\nNLM Support Center\nAccessibility\nCareers\nNLM | NIH | HHS | USA.gov", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/dfcdbc18-ee53-488a-acba-08962a54e4f3", "content_hash": "5c065a874376a951396b9bfa46346d9979df536c3c2032f6bdf8068b2b72c82e", "created_at": "2026-03-28T05:10:39.827142916Z"}
{"id": "669e5c2b-4ac2-40d9-be79-fdc2342a7d42", "source": "brain", "text": "Protein BLAST: search protein databases using a protein query\n\nProtein BLAST: search protein databases using a protein query\nAn official website of the United States government\nHere's how you know\nThe .gov means it\u2019s official.\nFederal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you\u2019re on a federal government site.\nThe site is secure.\nThe https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.\nSkip to main page content\nLog in\nShow account info\nClose\nAccount\nLogged in as:\nusername\nDashboard (My NCBI)\nPublications (My Bibliography)\nAccount settings\nLog out\nAccess keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation\nBLAST \u00ae \u00bb blastp suite\nHome\nRecent Results\nSaved Strategies\nHelp\nStandard Protein BLAST\nBLASTP programs search protein databases using a protein query. more...\nReset page\nBookmark\nEnter Query Sequence\nEnter accession number(s), gi(s), or FASTA sequence(s) Help Clear\nEnter query sequence(s) in the text area. It automatically determines the format of the input. To allow this feature, certain conventions are required with regard to the input of identifiers. more...\nCCK23135\nQuery subrange Help\nEnter coordinates for a subrange of the query sequence. The BLAST search will apply only to the residues in the range. Sequence coordinates are from 1 to the sequence length.The range includes the residue at the To coordinate. more...\nQuery subrangeFrom\nQuery subrangeTo\nOr, upload file\nHelp\nUse the browse button to upload a file from your local disk. The file may contain a single sequence or a list of sequences. The data may be either a list of database accession numbers, NCBI gi numbers, or sequences in FASTA format.\nGenetic code\nStandard (1) Vertebrate Mitochondrial (2) Yeast Mitochondrial (3) Mold Mitochondrial; ... (4) Invertebrate Mitochondrial (5) Ciliate Nuclear; ... (6) Echinoderm Mitochondrial (9) Euplotid Nuclear (10) Bacteria and Archaea (11) Alternative Yeast Nuclear (12) Ascidian Mitochondrial (13) Flatworm Mitochondrial (14) Chlorophycean Mitochondrial (16) Trematode Mitochondrial (21) Scenedesmus obliquus Mitochondrial (22) Thraustochytrium Mitochondrial (23) Pterobranchia Mitochondrial (24) Candidate Division SR1 and Gracilibacteria (25) Pachysolen tannophilus Nuclear (26) Karyorelict Nuclear (27) Condylostoma Nuclear (28) Mesodinium Nuclear (29) Peritrich Nuclear (30) Blastocrithidia Nuclear (31)\nJob Title\nEnter a descriptive title for your BLAST search Help\nThis title appears on all BLAST results and saved searches.\nAlign two or more sequences Help\nEnter one or more queries in the top text box and one or more subject sequences in the lower text box. Then use the BLAST button at the bottom of the page to align your sequences.\nTo get the CDS annotation in the output, use only the NCBI accession or gi number for either the query or subject. Reformat the results and check 'CDS feature' to display that annotation.\nEnter Subject Sequence\nEnter accession number(s), gi(s), or FASTA sequence(s) Help Clear\nSubject sequence(s) to be used for a BLAST search should be pasted in the text area. It automatically determines the format or the input. To allow this feature there are certain conventions required with regard to the input of identifiers. more...\nSubject subrange Help\nEnter coordinates for a subrange of the subject sequence. The BLAST search will apply only to the residues in the range. Sequence coordinates are from 1 to the sequence length.The range includes the residue at the To coordinate. more...\nSubject subrangeFrom\nSubject subrangeTo\nOr, upload file\nHelp\nUse the browse button to upload a file from your local disk. The file may contain a single sequence or a list of sequences. The data may be either a list of database accession numbers, NCBI gi numbers, or sequences in FASTA format.\nChoose Search Set\nDatabase\n\u2666Database sequences non-default value ClusteredNR (nr_cluster_seq) RefSeq Select proteins (refseq_select) Reference proteins (refseq_protein) Model Organisms (landmark) UniProtKB/Swiss-Prot(swissprot) Non-redundant protein sequences (nr) Patented protein sequences(pataa) Protein Data Bank proteins(pdb) Metagenomic proteins(env_nr) Transcriptome Shotgun Assembly proteins (tsa_nr) Help\nSelect the sequence database to run searches against. No BLAST database contains all the sequences at NCBI. BLAST databases are organized by informational content (nr, RefSeq, etc.) or by sequencing technique (WGS, EST, etc.). more...\nOrganism\nOptional\nexclude\nEnter organism common name, binomial, or tax id. Only 20 top taxa will be shown. Help\nStart typing in the text box, then select your taxid. Use the \"plus\" button to add another organism or group, and the \"exclude\" checkbox to narrow the subset. The search will be restricted to the sequences in the database that correspond to your subset.\nExclude\nOptional\nExclude Models (XM/XP) Non-redundant RefSeq proteins (WP) Exclude Uncultured/environmental sample sequences\nEntrez Query\nOptional\nCreate custom database\nEnter an Entrez query to limit search Help\nYou can use Entrez query syntax to search a subset of the selected BLAST database. This can be helpful to limit searches to molecule types, sequence lengths or to exclude organisms. more...\nProgram Selection Optimize for\nOptimize for Highly similar sequences (megablast)\nOptimize for More dissimilar sequences (discontiguous megablast)\nOptimize for Somewhat similar sequences (blastn)\nChoose a BLAST algorithm Help\nMegablast is intended for comparing a query to closely related sequences and works best if the target percent identity is 95% or more but is very fast.\nDiscontiguous megablast uses an initial seed that ignores some bases (allowing mismatches) and is intended for cross-species comparisons.\nBlastN is slow, but allows a word-size down to seven bases.\nmore...\nAlgorithm\nAlgorithm Quick BLASTP (Accelerated protein-protein BLAST)\nAlgorithm blastp (protein-protein BLAST)\nAlgorithm PSI-BLAST (Position-Specific Iterated BLAST)\nAlgorithm PHI-BLAST (Pattern Hit Initiated BLAST)\nEnter a PHI pattern Help\nEnter a PHI pattern to start the search. PHI-BLAST may perform better than simple pattern searching because it filters out false positives (pattern matches that are probably random and not indicative of homology).\nAlgorithm DELTA-BLAST (Domain Enhanced Lookup Time Accelerated BLAST)\nChoose a BLAST algorithm Help\nQuickBLASTP is an accelerated version of BLASTP that is very fast and works best if the target percent identity is 50% or more.\nBlastP simply compares a protein query to a protein database.\nPSI-BLAST allows the user to build a PSSM (position-specific scoring matrix) using the results of the first BlastP run.\nPHI-BLAST performs the search but limits alignments to those that match a pattern in the query.\nDELTA-BLAST constructs a PSSM using the results of a Conserved Domain Database search and searches a sequence database.\nSearch using Blastp (protein-protein BLAST)\nShow results in a new window\nNote: Parameter values that differ from the default are highlighted in yellow and marked with \u2666 sign\nAlgorithm parameters\nRestore default search parameters\nGeneral Parameters Max target sequences\n\u2666Max target sequences non-default value 10 50 100 <PHONE_1> 5000\nSelect the maximum number of aligned sequences to display Help\nMaximum number of aligned sequences to display (the actual number of alignments may be greater than this).\nShort queries\nAutomatically adjust parameters for short input sequences Help\nAutomatically adjust word size and other parameters to improve results for short queries.\nExpect threshold\n\u2666Expect threshold non-default value Help\nExpected number of chance matches in a random model. more... Expect value tutorial\nWord size\n\u2666Word size non-default value 2 3 5 6 Help\nThe length of the seed that initiates an alignment. more...\nMax matches in a query range\n\u2666Max matches in a query range non-default value Help\nLimit the number of matches to a query range. This option is use", "license": "apache-2.0", "quality_score": 0.5, "provenance": "pi.ruv.io/memory/669e5c2b-4ac2-40d9-be79-fdc2342a7d42", "content_hash": "8061833fb5cdcacd83228e0b174c3e10af92e2511b59a317a931b20f80c5557d", "created_at": "2026-03-28T05:10:39.725539017Z"}